LYAG/GAA Antibody


Western Blot: LYAG/GAA Antibody [NBP1-69295] - This Anti-GAA antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.
Immunocytochemistry/ Immunofluorescence: LYAG/GAA Antibody [NBP1-69295] - LYAG was probed in human fibroblasts fixed with 4% PFA. Cells were permeabilized and blocked in 0.1% Tween and 1% Bovine serum albumin. Anti-LYAG more
Immunocytochemistry/ Immunofluorescence: LYAG/GAA Antibody [NBP1-69295] - Antibody Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue Observed Staining: Cytoplasmic in alveolar type I cells

Product Details

Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, ZeSpecies Glossary
Applications WB, ICC/IF, IHC

Order Details

LYAG/GAA Antibody Summary

Synthetic peptides corresponding to GAA(glucosidase, alpha; acid ) The peptide sequence was selected from the N terminal of GAA. Peptide sequence FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against GAA and was validated on Western blot.
Theoretical MW
98 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
LYAG/GAA Knockout 293T Cell Lysate
Reviewed Applications
Read 1 Review rated 3
NBP1-69295 in the following applications:

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LYAG/GAA Antibody

  • Acid alpha-Glucosidase
  • Acid Maltase
  • Aglucosidase alfa
  • EC
  • GAA
  • glucosidase, alpha; acid
  • LYAG
  • Lysosomal alphaGlucosidase
  • Lysosomal alpha-Glucosidase


GAA is acid alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. Different forms of acid alpha-glucosidase are obtained by proteolytic processing. Defects in this gene are the cause of glycogen storage disease II, also known as Pompe's disease, which is an autosomal recessive disorder with a broad clinical spectrum. This gene encodes acid alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. Different forms of acid alpha-glucosidase are obtained by proteolytic processing. Defects in this gene are the cause of glycogen storage disease II, also known as Pompe's disease, which is an autosomal recessive disorder with a broad clinical spectrum. Three transcript variants encoding the same protein have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt, Po, Bv, Ca, Eq, GP
Applications: WB
Species: Hu, Mu, Rt, Mk
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, PAGE, Flow-CS, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ch, Rt(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO

Publications for LYAG/GAA Antibody (NBP1-69295) (0)

There are no publications for LYAG/GAA Antibody (NBP1-69295).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for LYAG/GAA Antibody (NBP1-69295) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-69295:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry LYAG/GAA NBP1-69295
reviewed by:
Pierre Jean Beltran
ICC Human 04/05/2017


Sample TestedHuman fibroblast


CommentsLYAG was probed in human fibroblasts fixed with 4% PFA. Cells were permeabilized and blocked in 0.1% Tween and 1% Bovine serum albumin. Anti-LYAG was incubated overnight at 4C in PBS with 0.1% Tween and 1% Bovine serum albumin. Secondary antibody was anti-rabbit conjugated to Alexa Fluor 568. LYAG is shown in green and the nucleus in blue (Hoescht stain).

Overall, the anitibody gave good signal, but with a significantly high cell-specific background as evident by some nuclear stain.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LYAG/GAA Antibody (NBP1-69295) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional LYAG/GAA Products

Bioinformatics Tool for LYAG/GAA Antibody (NBP1-69295)

Discover related pathways, diseases and genes to LYAG/GAA Antibody (NBP1-69295). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LYAG/GAA Antibody (NBP1-69295)

Discover more about diseases related to LYAG/GAA Antibody (NBP1-69295).

Pathways for LYAG/GAA Antibody (NBP1-69295)

View related products by pathway.

PTMs for LYAG/GAA Antibody (NBP1-69295)

Learn more about PTMs related to LYAG/GAA Antibody (NBP1-69295).

Blogs on LYAG/GAA

There are no specific blogs for LYAG/GAA, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Pierre Jean Beltran
Application: ICC
Species: Human


Gene Symbol GAA