LXR alpha/NR1H3 Antibody (7Z4H10)

Western Blot: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Western blot analysis of extracts of various cell lines, using LXR alpha/NR1H3 Rabbit mAb (NBP3-16304) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Immunocytochemistry/Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Immunofluorescence analysis of NIH-3T3 cells using LXR alpha/NR1H3 Rabbit mAb (NBP3-16304) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Immunohistochemistry of paraffin-embedded mouse testis using LXR alpha/NR1H3 Rabbit mAb (NBP3-16304) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunocytochemistry/Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Immunofluorescence analysis of C6 cells using LXR alpha/NR1H3 Rabbit mAb (NBP3-16304) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Immunofluorescence analysis of Hep G2 cells using LXR alpha/NR1H3 Rabbit mAb (NBP3-16304) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Immunohistochemistry of paraffin-embedded rat ovary using LXR alpha/NR1H3 Rabbit mAb (NBP3-16304) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Immunohistochemistry of paraffin-embedded human colon using LXR alpha/NR1H3 Rabbit mAb (NBP3-16304) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Immunofluorescence analysis of C6 cells using LXR alpha/NR1H3 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Confocal imaging of C2C12 cells using LXR alpha/NR1H3 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [NBP3-16304] - Immunofluorescence analysis of NIH-3T3 cells using LXR alpha/NR1H3 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [LXR alpha/NR1H3] - Confocal imaging of C2C12 cells using LXR alpha/NR1H3 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [LXR alpha/NR1H3] - Immunofluorescence analysis of NIH-3T3 cells using LXR alpha/NR1H3 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: LXR alpha/NR1H3 Antibody (7Z4H10) [LXR alpha/NR1H3] - Immunofluorescence analysis of C6 cells using LXR alpha/NR1H3 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 7Z4H10
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

LXR alpha/NR1H3 Antibody (7Z4H10) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LXR alpha/NR1H3 (Q13133). MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSV
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: NR1H3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 50 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LXR alpha/NR1H3 Antibody (7Z4H10)

• alpha
• Liver X receptor alpha
• liver X receptor-alpha
• LXR alpha
• LXRA
• NR1H3
• Nuclear receptor subfamily 1 group H member 3
• nuclear receptor subfamily 1, group H, member 3
• oxysterols receptor LXR-alpha
• RLD-1

Background

Liver X Receptors (LXRs) are oxysterol activated nuclear receptors which are involved in the regulation of cholesterol metabolism and bile acids. Two known isoforms, alpha and beta, are differentially expressed. The alpha isoform is predominantly expressed in liver, whereas the beta isoform expression has been shown to be ubiquitous.

LXR antibodies are useful for lipid and cholesterol metabolism studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NR1H3