LRP2 Antibody - BSA Free

Immunohistochemistry-Paraffin: LRP2 Antibody [NBP2-39033] - Analysis in human parathyroid gland and placenta tissues. Corresponding LRP2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: LRP2 Antibody [NBP2-39033] - Staining of human placenta shows no positivity in trophoblastic cells as expected.

Immunohistochemistry-Paraffin: LRP2 Antibody [NBP2-39033] - Staining of human kidney shows strong membranous positivity in cells in tubules.

Immunohistochemistry-Paraffin: LRP2 Antibody [NBP2-39033] - Staining of human lymph node shows no positivity in germinal center cells as expected.

Immunohistochemistry-Paraffin: LRP2 Antibody [NBP2-39033] - Staining of human parathyroid gland shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: LRP2 Antibody [NBP2-39033] - Staining of human small intestine shows no positivity in glandular cells as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LRP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LRP2 Antibody - BSA Free (NBP2-39033) is a polyclonal antibody validated for use in IHC. Anti-LRP2 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NNDRIYWSDFKEDVIETIKYDGTDRRVIAKEAMNPYSLDIFEDQLYWISKEKGEVWKQNKFGQGKKEKTLVVNPWLTQVRIFHQLRYNKSVP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LRP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 -1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  LRP2 Protein (NBP2-39033PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LRP2 Antibody - BSA Free

• calcium sensor protein
• DBS
• DBSlow-density lipoprotein receptor-related protein 2
• EC 1.1.2.3
• EC 3.4.21.9
• Glycoprotein 330
• gp330
• Heymann nephritis antigen homolog
• low density lipoprotein receptor-related protein 2
• LRP2
• LRP-2
• Megalin

Background

Megalin/gp330, an approx. 600 kDa transmembrane glycoprotein is a large cell surface receptor that mediates the binding and internalization of a number of structurally and functionally distinct ligands from the lipoprotein and protease inhibitor families.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LRP2 Antibody (NBP2-39033)(2)

Publications using NBP2-39033

• Jessica M. Vanslambrouck, Sean B. Wilson, Ker Sin Tan, Ella Groenewegen, Rajeev Rudraraju, Jessica Neil et al. Enhanced metanephric specification to functional proximal tubule enables toxicity screening and infectious disease modelling in kidney organoids Nature Communications 2022-10-08 [PMID: 36209212] (Human)
• Li Q, Lei F, Tang Y et al. Megalin mediates plasma membrane to mitochondria cross-talk and regulates mitochondrial metabolism Cell. Mol. Life Sci. 2018-06-09 [PMID: 29916093] (Human)

Bioinformatics

• Gene Symbol: LRP2
• Uniprot:
  • P98164()