LRH-1/NR5A2 Antibody

Immunohistochemistry-Paraffin: LRH-1/NR5A2 Antibody [NBP1-90049] - Staining of human rectum shows nuclear positivity in glandular cells.

Product Discontinued

LRH-1/NR5A2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPHLILELL
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NR5A2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LRH-1/NR5A2 Antibody

• Alpha-1-fetoprotein transcription factor
• B1-binding factor
• b1-binding factor, hepatocyte transcription factor which activates enhancer IIof hepatitis B virus
• B1F
• B1F2
• fetoprotein-alpha 1 (AFP) transcription factor
• FTFLRH1
• FTZ-F1 beta
• FTZ-F1
• FTZ-F1beta
• HB1F
• hB1F-2
• hB1FCYP7A promoter-binding factor
• Hepatocytic transcription factor
• Liver receptor homolog 1
• liver receptor homolog-1
• LRH1
• LRH-1
• LRH-1CPF
• NR5A2
• nuclear receptor NR5A2
• nuclear receptor subfamily 5 group A member 2
• nuclear receptor subfamily 5, group A, member 2

Background

Neuregulin 1 (NRG1) was originally identified as a 44-kD glycoprotein that interacts with the NEU/ERBB2 receptor tyrosine kinase to increase its phosphorylation on tyrosine residues. It is known that an extraordinary variety of different isoforms are produced from the NRG1 gene by alternative splicing. These isoforms include heregulins (HRGs), glial growth factors (GGFs) and sensory and motor neuron-derived factor (SMDF). They are tissue-specifically expressed and differ significantly in their structure. The HRG isoforms all contain immunoglobulin (Ig) and epidermal growth factor-like (EGF-like) domains. GGF and GGF2 isoforms contain a kringle-like sequence plus Ig and EGF-like domains; and the SMDF isoform shares only the EGF-like domain with other isoforms. The receptors for all NRG1 isoforms are the ERBB family of tyrosine kinase transmembrane receptors. Through interaction with ERBB receptors, NRG1 isoforms induce the growth and differentialtion of epithelial, neuronal, glial, and other types of cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LRH-1/NR5A2 Antibody (NBP1-90049)(1)

Publication using NBP1-90049

• Benod C, Vinogradova MV, Jouravel N et al. Nuclear receptor liver receptor homologue 1 (LRH-1) regulates pancreatic cancer cell growth and proliferation. Proc Natl Acad Sci U S A 2011-10-01 [PMID: 21949357]

Bioinformatics

• Gene Symbol: NR5A2