LRH-1/NR5A2 Antibody

Images

 
Immunohistochemistry-Paraffin: LRH-1/NR5A2 Antibody [NBP1-90048] - Staining of human rectum shows nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRH-1/NR5A2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NR5A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LRH-1/NR5A2 Protein (NBP1-90048PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRH-1/NR5A2 Antibody

  • Alpha-1-fetoprotein transcription factor
  • B1-binding factor
  • b1-binding factor, hepatocyte transcription factor which activates enhancer IIof hepatitis B virus
  • B1F
  • B1F2
  • fetoprotein-alpha 1 (AFP) transcription factor
  • FTFLRH1
  • FTZ-F1 beta
  • FTZ-F1
  • FTZ-F1beta
  • HB1F
  • hB1F-2
  • hB1FCYP7A promoter-binding factor
  • Hepatocytic transcription factor
  • Liver receptor homolog 1
  • liver receptor homolog-1
  • LRH1
  • LRH-1
  • LRH-1CPF
  • NR5A2
  • nuclear receptor NR5A2
  • nuclear receptor subfamily 5 group A member 2
  • nuclear receptor subfamily 5, group A, member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-46522
Species: Hu
Applications: WB, IHC
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NB400-153
Species: Hu
Applications: WB, ICC/IF
MAB9120
Species: Hu
Applications: ICC
PP-H7431-00
Species: Hu
Applications: WB
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
AF9024
Species: Mu, Rt
Applications: WB, IHC
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-50218
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-68883
Species: Hu, Mu, Mk
Applications: WB, IHC
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA

Publications for LRH-1/NR5A2 Antibody (NBP1-90048) (0)

There are no publications for LRH-1/NR5A2 Antibody (NBP1-90048).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRH-1/NR5A2 Antibody (NBP1-90048) (0)

There are no reviews for LRH-1/NR5A2 Antibody (NBP1-90048). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LRH-1/NR5A2 Antibody (NBP1-90048) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRH-1/NR5A2 Products

Bioinformatics Tool for LRH-1/NR5A2 Antibody (NBP1-90048)

Discover related pathways, diseases and genes to LRH-1/NR5A2 Antibody (NBP1-90048). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRH-1/NR5A2 Antibody (NBP1-90048)

Discover more about diseases related to LRH-1/NR5A2 Antibody (NBP1-90048).
 

Pathways for LRH-1/NR5A2 Antibody (NBP1-90048)

View related products by pathway.

PTMs for LRH-1/NR5A2 Antibody (NBP1-90048)

Learn more about PTMs related to LRH-1/NR5A2 Antibody (NBP1-90048).
 

Research Areas for LRH-1/NR5A2 Antibody (NBP1-90048)

Find related products by research area.

Blogs on LRH-1/NR5A2

There are no specific blogs for LRH-1/NR5A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRH-1/NR5A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NR5A2
Entrez