LRCH4 Antibody - BSA Free

Immunohistochemistry-Paraffin: LRCH4 Antibody [NBP1-82821] - Staining in human spleen and liver tissues using anti-LRCH4 antibody. Corresponding LRCH4 RNA-seq data are presented for the same tissues.

Western Blot: LRCH4 Antibody [NBP1-82821] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: LRCH4 Antibody [NBP1-82821] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: LRCH4 Antibody [NBP1-82821] - Staining of human spleen shows high expression.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LRCH4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LRCH4 Antibody - BSA Free (NBP1-82821) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ELSFRISELAREPRGPRERKEDGSADGDPVQIDFIDSHVPGEDEERGTVEEQRPPELSPGAGDRERAPSSRRE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LRCH4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  LRCH4 Protein (NBP1-82821PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LRCH4 Antibody - BSA Free

• FLJ40101
• FLJ46315
• leucine rich repeat neuronal 4
• Leucine-rich neuronal protein
• leucine-rich repeat and calponin homology domain-containing protein 4
• Leucine-rich repeat neuronal protein 4
• leucine-rich repeats and calponin homology (CH) domain containing 4
• LRN
• LRRN1
• LRRN4
• PP14183

Background

The LRCH4 gene encodes a protein that contains leucine-rich repeats (LRR) at its amino terminus and that is known to be involved in ligand binding. The carboxyl terminus may act as a membrane anchor. Identified structural elements suggest that the encoded prot

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LRCH4