LMX1b Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

LMX1b Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LMX1b
  
  

  Source: E.coli

  Amino Acid Sequence: YEKEKDLLSSVSPDESDSVKSEDEDGDMKPAKGQGSQSKGSG

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: LMX1B
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24958It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LMX1b Recombinant Protein Antigen

• LIM homeobox transcription factor 1, beta
• LIM homeobox transcription factor 1-beta
• LIM/homeobox protein 1.2
• LIM/homeobox protein LMX1B
• LMX1.2
• LMX-1.2
• MGC138325
• MGC142051
• NPS1

Background

LMX1B is a gene that codes for a protein with three isoforms, measuring 402, 395, and 406 amino acids in length with weights of approximately 45, 44, and 45 kDa respectively. LMX1B is necessary for the specification of dorsal limb fate. Current studies are being done on several diseases and disorders related to this gene including Meier-Gorlin syndrome, steroid-resistant nephrotic syndrome, sex reversal, attention deficit hyperactivity disorder, cleft lip/palate, familial Mediterranean fever, genitopatellar syndrome, major depressive disorder, nail dysplasia, short stature, heart block, and neuronitis. LMX1B has also been shown to have interactions with LDB1, TCF3, SSBP3, ALX4, and LDB2 in pathways such as the SIDS susceptibility pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LMX1B