Home » LMX1A » LMX1A Antibodies » LMX1A Antibody

LMX1A Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: LMX1A Antibody [NBP2-84144] - WB Suggested Anti-LMX1A Antibody Titration: 5.0ug/ml. Positive Control: SP2/0 cell lysate
Western Blot: LMX1A Antibody [NBP2-84144] - WB Suggested Anti-LMX1A Antibody Titration: 5.0ug/ml. Positive Control: SP2/0 cell lysate

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

LMX1A Antibody Summary

Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse LMX1A. Peptide sequence: AIEQSVYNSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGD The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
LMX1A
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for LMX1A Antibody

  • LIM homeobox transcription factor 1, alpha
  • LMX1.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

FGF-8
[Unconjugated]
423-F8
1 μg/lane of Recombinant Human/Mouse FGF-8b was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 23 kDa.
Recombinant Human/Mouse FGF-8b (Catalog # 423-F8) stimulates cell proliferation in the NR6R‑3T3 mouse fibroblast cell line. The ED50 for this effect is 6.5-40 ng/mL in the presence of 1 μg/mL heparin.
(3 Reviews)
(55 Publications)
Species: Hu, Mu
Applications: BA
Sonic Hedgehog/Shh
[Unconjugated]
1845-SH/CF
1 μg/lane of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 22 kDa.
Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus (Catalog #1845-SH/CF) induces alkaline phosphatase production by the C3H10T1/2 mouse embryonic fibroblast cell line. The ED50 for this effect is 0.1‑0.4 μg/mL.
MALDI-TOF analysis of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus. The major peak corresponds to the calculated molecular mass, 19814 Da. The minor peak at 20029  is a matrix-associated artifact of the MALDI-TOF.
(50 Publications)
Species: Hu
Applications: BA
PITX3 Antibody
NBP2-85481
Western Blot: PITX3 Antibody [NBP2-85481] - WB Suggested Anti-PITX3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: MCF7 cell lysate
Western Blot: PITX3 Antibody [NBP2-85481] - Host: Rabbit. Target Name: PITX3. Sample Tissue: Human Hela Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: PITX3 Antibody [NBP2-85481] - Host: Rabbit. Target Name: PITX3. Sample Type: 293T. Antibody Dilution: 1.0ug/mlPITX3 is supported by BioGPS gene expression data to be expressed in HEK293T
Species: Hu
Applications: IHC, IHC-P, WB
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen: Tyrosine Hydroxylase Antibody [NB300-109] - 10x Magnification cryo-sections mouse: primary antibody: anti-rb TH: 1:500; o.n. secondary antibody: 1:500 dk-anti-rb DyLight488. IHC-Fr image submitted by a verified customer review.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the mushroom body. All panels show a right brain hemisphere (dorsal to the top, medial to the right), except panels M-O (posterior to the top). Tyrosine hydroxylase (TH) immunoreactivity is shown in magenta (A, D, G, J, M) and synapsin immunoreactivity in green (B, E, H, K, N). Corresponding merged images in C, F, I, L, O. Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the central complex and the lateral accessory lobe. A-D: Frontal sections (immunoperoxidase preparations, dorsal to the top). E: Horizontal section (immunofluorescent preparation, posterior to the top). Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
(7 Reviews)
(173 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
HNF-3 beta/FoxA2
Antibody [Unconjugate ...
AF2400
Mouse splenocytes were fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. HNF‑3 beta /FoxA2/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human HNF‑3 beta /FoxA2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2400) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The E-RABP promoter was detected by standard PCR.
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, Jurkat human acute T cell leukemia cell line, and K562 human chronic myelogenous leukemia cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human HNF‑3 beta /FoxA2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2400) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for HNF‑3 beta /FoxA2 at approximately 48 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
HNF‑3 beta /FoxA2 was detected in immersion fixed endoderm differentiated BG01V human embryonic stem cells using 10 µg/mL Goat Anti-Human HNF‑3 beta /FoxA2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2400) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(2 Reviews)
(56 Publications)
Species: Hu
Applications: ChIP, ICC, IHC, WB
LMX1b Antibody -
BSA Free
NBP2-41194
Western Blot: LMX1b Antibody [NBP2-41194] - Western blot analysis of LMX1B in A-20 cell lysate with LMX1B antibody at (A) 1 and (B) 2 ug/mL.
Immunohistochemistry-Paraffin: LMX1b Antibody [NBP2-41194] - Human brain tissue with LMX1B antibody at 5 ug/mL.
Immunocytochemistry/Immunofluorescence: LMX1b Antibody [NBP2-41194] - Immunofluorescence of LMX1B in human brain tissue with LMX1B antibody at 20 ug/mL.
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Nurr1/NGFI-B
beta/NR4A2 Antibody [ ...
AF2156
Nurr1/NGFI‑B beta /NR4A2 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Goat Anti-Human/Mouse Nurr1/NGFI‑B beta /NR4A2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2156) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. Staining was performed using our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Nurr1/NGFI‑B beta /NR4A2 was detected in immersion fixed paraffin-embedded sections of mouse brain (hippocampus) using Goat Anti-Human/Mouse Nurr1/NGFI‑B beta /NR4A2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2156) at 15 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neurons. Staining was performed using our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(6 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
Neurogenin-2
Antibody (7G4)
MAB3314
Neurogenin-2 Antibody (7G4)
(6 Publications)
Species: Hu, Rt
Applications: IHC
MSX1 Antibody
[Unconjugated]
AF5045
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line. Gels were loaded with 30 μg of whole cell lysate (WCL), 20 μg of cytoplasmic (Cyto), and 10 μg of nuclear extracts (Nuc). PVDF membrane was probed with 0.1 µg/mL Goat Anti-Human/Mouse MSX1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5045) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band for MSX1 was detected at approximately 40 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
MSX1 was detected in immersion fixed paraffin-embedded sections of human ovarian cancer tissue using Goat Anti-Human/Mouse MSX1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5045) at 0.3, 1.0 and 3.0 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(3 Reviews)
(6 Publications)
Species: Hu, Mu
Applications: IHC, WB
Wnt-1 Antibody
(10C8)
NBP1-51575
Immunocytochemistry/Immunofluorescence: Wnt-1 Antibody (10C8) [NBP1-51575] - Confocal immunofluorescence analysis of Hela (left) and 3T3-L1 (right) cells using WNT1 mouse mAb (green). Red: Actin filaments have been labeled with DY-554 phalloidin. Blue: DRAQ5 fluorescent DNA dye.
Immunohistochemistry-Paraffin: Wnt-1 Antibody (10C8) [NBP1-51575] - Analysis of human LAdrenal tissues using WNT1 mouse mAb.
Western Blot: Wnt-1 Antibody (10C8) [NBP1-51575] - Analysis using WNT1 mouse mAb against NIH/3T3 (1), 3T3L1 (2) and Hela (3) cell lysate.
(1 Publication)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
ASCL1/Mash1
Antibody [Unconjugate
AF2567
ASCL1/Mash1 was detected in immersion fixed paraffin-embedded sections of mouse embryo (13 d.p.c., cross-section through developing CNS) using Goat Anti-Mouse ASCL1/Mash1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2567) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cell nuclei. Staining was performed using our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(2 Reviews)
(2 Publications)
Species: Mu
Applications: IHC, WB
PDLIM5 Antibody
NBP1-84843
Immunocytochemistry/Immunofluorescence: PDLIM5 Antibody [NBP1-84843] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane, cytosol & focal adhesion sites.
Immunohistochemistry-Paraffin: PDLIM5 Antibody [NBP1-84843] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: PDLIM5 Antibody [NBP1-84843] - Staining in human heart muscle and testis tissues.. Corresponding PDLIM5 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Otx2 Antibody
[Unconjugated]
AF1979
Otx2 was detected in immersion fixed NTera‑2 human testicular embryonic carcinoma cell line using Goat Anti-Human Otx2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1979) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Otx2 was detected in immersion fixed paraffin-embedded sections of mouse embryo (14 d.p.c.) using Goat Anti-Human Otx2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1979) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to developing nervous system. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Simple Western lane view shows lysates of IMR‑32 human neuroblastoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Otx2 at approximately 48 kDa (as indicated) using 10 µg/mL of Goat Anti-Human Otx2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1979) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(8 Reviews)
(63 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Wnt-7a Antibody
NBP2-20913
Western Blot: Wnt-7a Antibody [NBP2-20913] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with WNT7A antibody diluted at 1:5000.
Immunohistochemistry-Paraffin: Wnt-7a Antibody [NBP2-20913] - Paraffin-embedded mouse pancreas. WNT7A antibody dilution: 1:500.
Immunohistochemistry-Paraffin: Wnt-7a Antibody [NBP2-20913] - Paraffin-embedded mouse stomach. WNT7A antibody dilution: 1:500.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
EN1/Engrailed 1
Antibody (3H2)
H00002019-M04
ELISA: EN1/Engrailed 1 Antibody (3H2) [H00002019-M04] - Detection limit for recombinant GST tagged EN1 is approximately 1ng/ml as a capture antibody.
Immunohistochemistry-Paraffin: EN1/Engrailed 1 Antibody (3H2) [H00002019-M04] - Analysis of monoclonal antibody to EN1 on formalin-fixed paraffin-embedded human cerebellum. Antibody concentration 3 ug/ml
(1 Publication)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, IP, WB
NKX6.1 Antibody -
BSA Free
NBP1-49672
Immunohistochemistry-Paraffin: NKX6.1 Antibody [NBP1-49672] - Mouse pancreas tissue. IHC-P image submitted by a verified customer review.
Immunohistochemistry-Paraffin: NKX6.1 Antibody [NBP1-49672] - Paraffin embeded rat pancreatic tissue at 40x resolution stained for insulin (red) and NKX6.1 (NBP1-49672, green). IHC-P image submitted by a verified customer review.
Simple Western: NKX6.1 Antibody [NBP1-49672] - Image shows a specific band for NKX6.1 in 0.5 mg/mL of BTC-6 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(4 Reviews)
(12 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
FGF-4
[Unconjugated]
7460-F4/CF
FGF-4 [Unconjugated]
(2 Publications)
Species: Hu
Applications: BA
LMX1A Antibody
NBP2-84144
LMX1A Antibody
Species: Mu
Applications: WB

Publications for LMX1A Antibody (NBP2-84144) (0)

There are no publications for LMX1A Antibody (NBP2-84144).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMX1A Antibody (NBP2-84144) (0)

There are no reviews for LMX1A Antibody (NBP2-84144). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LMX1A Antibody (NBP2-84144) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LMX1A Products

Bioinformatics Tool for LMX1A Antibody (NBP2-84144)

Discover related pathways, diseases and genes to LMX1A Antibody (NBP2-84144). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMX1A Antibody (NBP2-84144)

Discover more about diseases related to LMX1A Antibody (NBP2-84144).
 

Pathways for LMX1A Antibody (NBP2-84144)

View related products by pathway.

PTMs for LMX1A Antibody (NBP2-84144)

Learn more about PTMs related to LMX1A Antibody (NBP2-84144).

Blogs on LMX1A

There are no specific blogs for LMX1A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMX1A Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol LMX1A