LMX1A Antibody

Images

 
Western Blot: LMX1A Antibody [NBP2-84144] - WB Suggested Anti-LMX1A Antibody Titration: 5.0ug/ml. Positive Control: SP2/0 cell lysate

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LMX1A Antibody Summary

Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse LMX1A. Peptide sequence: AIEQSVYNSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGD The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
LMX1A
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for LMX1A Antibody

  • LIM homeobox transcription factor 1, alpha
  • LMX1.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

423-F8
Species: Hu, Mu
Applications: BA
1845-SH/CF
Species: Hu
Applications: BA
NBP2-85481
Species: Hu
Applications: IHC, IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
AF2400
Species: Hu
Applications: ChIP, ICC, IHC, WB
NBP2-41194
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF2156
Species: Hu, Mu
Applications: ICC, IHC, WB
MAB3314
Species: Hu, Rt
Applications: IHC
AF5045
Species: Hu, Mu
Applications: IHC, WB
NBP1-51575
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF2567
Species: Mu
Applications: IHC, WB
NBP1-84843
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1979
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-20913
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00002019-M04
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, IP, WB
NBP1-49672
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
7460-F4/CF
Species: Hu
Applications: BA
NBP2-84144
Species: Mu
Applications: WB

Publications for LMX1A Antibody (NBP2-84144) (0)

There are no publications for LMX1A Antibody (NBP2-84144).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMX1A Antibody (NBP2-84144) (0)

There are no reviews for LMX1A Antibody (NBP2-84144). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LMX1A Antibody (NBP2-84144) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LMX1A Products

Bioinformatics Tool for LMX1A Antibody (NBP2-84144)

Discover related pathways, diseases and genes to LMX1A Antibody (NBP2-84144). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMX1A Antibody (NBP2-84144)

Discover more about diseases related to LMX1A Antibody (NBP2-84144).
 

Pathways for LMX1A Antibody (NBP2-84144)

View related products by pathway.

PTMs for LMX1A Antibody (NBP2-84144)

Learn more about PTMs related to LMX1A Antibody (NBP2-84144).

Blogs on LMX1A

There are no specific blogs for LMX1A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMX1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LMX1A