LMP2/PSMB9 Antibody - BSA Free

Western Blot: LMP2/PSMB9 Antibody [NBP2-33681] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunohistochemistry-Paraffin: LMP2/PSMB9 Antibody [NBP2-33681] - Staining in human lymph node and kidney tissues using anti-PSMB9 antibody. Corresponding PSMB9 RNA-seq data are presented for the same tissues.

Immunohistochemistry: LMP2/PSMB9 Antibody [NBP2-33681] - Staining of human tonsil shows weak nuclear positivity in germinal center cells.

Immunohistochemistry-Paraffin: LMP2/PSMB9 Antibody [NBP2-33681] - Staining of human kidney shows low expression as expected.

Immunohistochemistry-Paraffin: LMP2/PSMB9 Antibody [NBP2-33681] - Staining of human lymph node shows high expression.

• Reactivity: Hu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LMP2/PSMB9 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGS
• Predicted Species: Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSMB9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  LMP2/PSMB9 Protein (NBP2-33681PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LMP2/PSMB9 Antibody - BSA Free

• beta1i
• LMP2
• LMP2MGC70470
• Low molecular mass protein 2
• Macropain chain 7
• Multicatalytic endopeptidase complex chain 7
• proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctionalpeptidase 2)
• proteasome catalytic subunit 1i
• Proteasome chain 7
• proteasome subunit beta 6i
• proteasome subunit beta type-9
• Proteasome subunit beta-1i
• proteasome-related gene 2
• PSMB6iproteasome (prosome, macropain) subunit, beta type, 9 (large multifunctionalprotease 2)
• PSMB9
• Really interesting new gene 12 protein
• RING12
• RING12EC 3.4.25.1

Background

Proteolytic degradation is critical to the maintenance of appropriate levels of short-lived and regulatory proteins as important and diverse as those involved in cellular metabolism, heat shock and stress response, antigen presentation, modulation of cell surface receptors and ion channels, cell cycle regulation, transcription, and signalling factors. The ubiquitin-proteasome pathway deconstructs most proteins in the eukaryotic cell cytosol and nucleus. Other proteins are degraded via the vacuolar pathway which includes endosomes, lysosomes, and the endoplasmic reticulum. The 26S proteasome is an ATP-dependent, multisubunit (~31), barrel-shaped molecular machine with an apparent molecular weight of ~2.5 MDa. It consists of a 20S proteolytic core complex which is crowned at one or both ends by 19S regulatory subunit complexes. The 19S regulatory subunits recognize ubiquitinated proteins and play an essential role in unfolding and translocating targets into the lumen of the 20S subunit. The PA28/11S REG Activator protein complex functions as a proteolytic activator. LMP2 is a catalytic subunit of the 20S proteasome and, upon interferon gamma-induction, replaces the delta subunit. LMP2 alters the specificity of the 20S proteasome and is critical for the production of MHC class I ligands, production of T-lymphocytes, and is suggested to increase the efficiency of antigen presentation of the immune response. Several genetic diseases are associated with defects in the ubiquitin-proteasome pathway. Some examples of affected proteins include those linked to cystic fibrosis (CF transmembrane regulator), Angelman's syndrome (E6-AP), and Liddle syndrome (endothelial sodium channels).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSMB9
• Uniprot:
  • P28065(Human)