PSMB10/MECL1 Antibody

Images

 
Western Blot: PSMB10/MECL1 Antibody [NBP1-88660] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-450
Immunocytochemistry/ Immunofluorescence: PSMB10/MECL1 Antibody [NBP1-88660] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: PSMB10/MECL1 Antibody [NBP1-88660] - Staining of human lymph node shows distinct cytoplasmic and nuclear positivity in lymphoid cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PSMB10/MECL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMB10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:2500-1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PSMB10/MECL1 Protein (NBP1-88660PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PSMB10/MECL1 Antibody

  • beta2i
  • FLJ00366
  • LMP10
  • LMP10Proteasome subunit beta-2i
  • Low molecular mass protein 10
  • Macropain subunit MECl-1
  • MECL1
  • MECl-1
  • MECL1EC 3.4.25.1
  • MGC1665
  • Multicatalytic endopeptidase complex subunit MECl-1
  • proteasome (prosome, macropain) subunit, beta type, 10
  • proteasome catalytic subunit 2i
  • Proteasome MECl-1
  • proteasome subunit beta 7i
  • proteasome subunit beta type-10
  • Proteasome subunit beta-2i
  • proteasome subunit MECL1
  • PSMB10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01817
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP1-83121
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13820
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00005721-M02
Species: Hu
Applications: WB, ELISA, IHC-P, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB100-64347
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq, Ft, Gt, GP, Mk, Rb
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF4715
Species: Mu
Applications: WB
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-88660
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PSMB10/MECL1 Antibody (NBP1-88660) (0)

There are no publications for PSMB10/MECL1 Antibody (NBP1-88660).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSMB10/MECL1 Antibody (NBP1-88660) (0)

There are no reviews for PSMB10/MECL1 Antibody (NBP1-88660). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PSMB10/MECL1 Antibody (NBP1-88660) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PSMB10/MECL1 Products

Bioinformatics Tool for PSMB10/MECL1 Antibody (NBP1-88660)

Discover related pathways, diseases and genes to PSMB10/MECL1 Antibody (NBP1-88660). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSMB10/MECL1 Antibody (NBP1-88660)

Discover more about diseases related to PSMB10/MECL1 Antibody (NBP1-88660).
 

Pathways for PSMB10/MECL1 Antibody (NBP1-88660)

View related products by pathway.

PTMs for PSMB10/MECL1 Antibody (NBP1-88660)

Learn more about PTMs related to PSMB10/MECL1 Antibody (NBP1-88660).

Blogs on PSMB10/MECL1

There are no specific blogs for PSMB10/MECL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSMB10/MECL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMB10
Entrez