PA28 Activator alpha Subunit/PSME1 Antibody

Images

 
Western Blot: PA28 Activator alpha Subunit/PSME1 Antibody [NBP1-83121] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PA28 Activator alpha Subunit/PSME1 Antibody [NBP1-83121] - Staining of human tonsil shows strong cytoplasmic positivity in germinal and non-germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PA28 Activator alpha Subunit/PSME1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSME1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PA28 Activator alpha Subunit/PSME1 Protein (NBP1-83121PEP)
Publications
Read Publications using
NBP1-83121 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PA28 Activator alpha Subunit/PSME1 Antibody

  • 11S regulator complex alpha subunit
  • 11S Regulator Complex Subunit alpha
  • 29-kD MCP activator subunit
  • IFI5111
  • IFI5111MGC8628
  • IGUP I-5111
  • Interferon gamma up-regulated I-5111 protein
  • interferon-gamma IEF SSP 5111
  • interferon-gamma-inducible protein 5111
  • PA28 Activator alpha Subunit
  • PA28A
  • PA28alphaActivator of multicatalytic protease subunit 1
  • proteasome (prosome, macropain) activator subunit 1 (PA28 alpha)
  • Proteasome activator 28 subunit alpha
  • proteasome activator complex subunit 1
  • proteasome activator subunit-1
  • PSME1
  • REG alpha
  • REGalpha
  • REG-alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005721-M02
Species: Hu
Applications: WB, ELISA, IHC-P, IP
NBP1-33498
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-01817
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88660
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
AF5540
Species: Mu
Applications: WB
NBP1-83121
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PA28 Activator alpha Subunit/PSME1 Antibody (NBP1-83121)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PA28 Activator alpha Subunit/PSME1 Antibody (NBP1-83121) (0)

There are no reviews for PA28 Activator alpha Subunit/PSME1 Antibody (NBP1-83121). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PA28 Activator alpha Subunit/PSME1 Antibody (NBP1-83121) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PA28 Activator alpha Subunit/PSME1 Products

Bioinformatics Tool for PA28 Activator alpha Subunit/PSME1 Antibody (NBP1-83121)

Discover related pathways, diseases and genes to PA28 Activator alpha Subunit/PSME1 Antibody (NBP1-83121). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PA28 Activator alpha Subunit/PSME1 Antibody (NBP1-83121)

Discover more about diseases related to PA28 Activator alpha Subunit/PSME1 Antibody (NBP1-83121).
 

Pathways for PA28 Activator alpha Subunit/PSME1 Antibody (NBP1-83121)

View related products by pathway.

PTMs for PA28 Activator alpha Subunit/PSME1 Antibody (NBP1-83121)

Learn more about PTMs related to PA28 Activator alpha Subunit/PSME1 Antibody (NBP1-83121).

Blogs on PA28 Activator alpha Subunit/PSME1

There are no specific blogs for PA28 Activator alpha Subunit/PSME1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PA28 Activator alpha Subunit/PSME1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSME1
Entrez