LMO4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LMO4 Antibody [NBP2-49342] - Staining of human cell line SiHa shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LMO4 Antibody [NBP2-49342] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LMO4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LMO4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LMO4 Recombinant Protein Antigen (NBP2-49342PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LMO4 Antibody

  • Breast tumor autoantigen
  • Crp3
  • Etohi4
  • LIM domain only 4
  • LIM domain only protein 4
  • LIM domain transcription factor LMO4
  • LMO4
  • LMO-4

Background

The LIM-only (LMO) proteins, LMO1 and LMO2, are nuclear factors that are characterized by a conserved LIM domain. The LIM domain consists of a cysteine-rich zinc-binding motif that is present in a variety of transcription factors, including the LIM homeobox (LHX) proteins expressed in the central nervous system and involved in cell differentiation. LMO1 and LMO2 are expressed in the adult CNS in a cell type-specific manner, where they are differentially regulated by neuronal activity and are involved in regulating the cellular differentiated phenotype of neurons. LMO2 lacks a specific DNA-binding homeobox domain but rather assembles into transcriptional regulatory complexes to mediate gene expression by interacting with the widely expressed nuclear LIM interactor (NLI). NLI, known also as CLIM-1, and the related protein CLIM-2 facilitate the formation of heteromeric LIM complexes and also enhance the nuclear retention of LIM proteins. LMO2 and the related protein LMO4 are expressed in thymic precursor cells. LMO4 is also expressed in mature T cells, cranial neural crest cells, somite, dorsal limb bud mesenchyme, motor neurons, and Schwann cell progenitors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31362
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
H00009079-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
NB110-78626
Species: Hu, Mu
Applications: ChIP, Flow, IF, IHC, IHC-P, IP, WB
NBP1-84843
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00004004-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NB100-79810
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP2-75090
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
314-BP/CF
Species: Hu
Applications: BA, BA
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
NBP1-87109
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-01488
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF7669
Species: Hu, Mu, Rt
Applications: WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
MCS00
Species: Mu
Applications: ELISA
NBP1-47492
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
H00000761-M02
Species: Hu, Mu
Applications: ELISA, Func, IHC, IHC-P, S-ELISA, WB
2458-RG
Species: Mu
Applications: Bind
AF2605
Species: Hu
Applications: ICC, IHC, Simple Western, WB

Publications for LMO4 Antibody (NBP2-49342) (0)

There are no publications for LMO4 Antibody (NBP2-49342).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMO4 Antibody (NBP2-49342) (0)

There are no reviews for LMO4 Antibody (NBP2-49342). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LMO4 Antibody (NBP2-49342) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LMO4 Products

Bioinformatics Tool for LMO4 Antibody (NBP2-49342)

Discover related pathways, diseases and genes to LMO4 Antibody (NBP2-49342). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMO4 Antibody (NBP2-49342)

Discover more about diseases related to LMO4 Antibody (NBP2-49342).
 

Pathways for LMO4 Antibody (NBP2-49342)

View related products by pathway.

PTMs for LMO4 Antibody (NBP2-49342)

Learn more about PTMs related to LMO4 Antibody (NBP2-49342).
 

Research Areas for LMO4 Antibody (NBP2-49342)

Find related products by research area.

Blogs on LMO4

There are no specific blogs for LMO4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMO4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LMO4