Lipoprotein Lipase/LPL Antibody (10E10P9) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 376-475 of human Lipoprotein Lipase/LPL (P06858). IPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDWWSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
LPL |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL
- Western Blot 1:1000 - 1:2000
|
| Theoretical MW |
53 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Lipoprotein Lipase/LPL Antibody (10E10P9)
Background
LPL, also known as Lipoprotein lipase, is a 475 amino acid that is 53 kDa, is a vascular lipase, but not synthesized in endothelial cells. It is anchored to the capillary endothelium by proteoglycans and acts as a catalyzer of triglycerides hydrolysis to release free fatty acids into the circulation and initiates the processing of triglyceride-rich lipoproteins such as chylomicrons and VLDL. It is being studied for its involvement in 150+ diseases and disorders including high density lipoprotein cholesterol level qtl 11, hyperlipoproteinemia, lipoprotein lipase deficiency, familial lipoprotein lipase deficiency, hyperlipoproteinemia type v, lipase deficiency combined, hyperlipoproteinemia type iii, glycogen storage disease, hyperlipidemia, hypertriglyceridemia, glucose intolerance, cetp deficiency, hypertension, fatty liver, nephrotic syndrome, kidney failure, and myocardial infarction. This protein has been shown to interact with 50 proteins including COPS6, PTPN4, RPL18A, ASCC2, KIAA1377 in developmental biology, transcriptional regulation of white adipocyte differentiation, lipid digestion, mobilization, and transport, metabolism, lipoprotein metabolism, glycerolipid metabolism, PPAR signaling pathway, and Alzheimer's disease pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Bv, Hu, Rb
Applications: ELISA, ICC/IF, IP, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu(-)
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu, Mu
Applications: WB, ELISA
Publications for Lipoprotein Lipase/LPL Antibody (NBP3-16334) (0)
There are no publications for Lipoprotein Lipase/LPL Antibody (NBP3-16334).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Lipoprotein Lipase/LPL Antibody (NBP3-16334) (0)
There are no reviews for Lipoprotein Lipase/LPL Antibody (NBP3-16334).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Lipoprotein Lipase/LPL Antibody (NBP3-16334) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Lipoprotein Lipase/LPL Products
Research Areas for Lipoprotein Lipase/LPL Antibody (NBP3-16334)
Find related products by research area.
|
Blogs on Lipoprotein Lipase/LPL