Recombinant Human LIF Protein

Product Discontinued

Recombinant Human LIF Protein Summary

• Description: A partial recombinant protein corresponding to the amino acids 23 - 202 of Human LIF
  
  

  Source: Escherichia coli

  Amino Acid Sequence:SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

• Preparation Method: Escherichia coli expression system
• Details of Functionality: The ED50 was determined by the dose-dependent differentiation of M1 myeloid leukemic cells was found to be in the range of 0.01 ng/mL.
• Protein/Peptide Type: Recombinant Protein
• Gene: LIF

Applications/Dilutions

• Dilutions:
  • Functional
  • SDS-Page
• Application Notes: This product is useful for SDS-PAGE and Functional assays.

Reactivity Notes

Human

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: Lyophilized from PBS, pH 4.5
• Preservative: No Preservative
• Reconstitution Instructions: Reconstitute with deionized water to desired concentration.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LIF Protein

• CDF
• D Factor
• DIA
• differentiation inhibitory activity
• differentiation stimulating factor
• Differentiation-stimulating factor
• Emfilermin
• HILDA
• HILDAcholinergic differentiation factor
• leukemia inhibitory factor (cholinergic differentiation factor)
• leukemia inhibitory factor
• LIF
• Melanoma-derived LPL inhibitor
• MLPLI

Background

LIF (leukemia inhibitory factor, myeloid leukemia inhibitory factor) a pleiotropic lymphoid factor was initially described as a factor that inhibits the proliferation of myeloid leukemia cells and induces their differentiation into macrophages. Other activities of LIF include inhibition of adipogenesis, cholinergic neuron differentiation and bone metabolism. Human and mouse LIF share 78% homology and activities of LIF are not species-specific. Human LIF is active on mouse cells, but murine LIF is not active on human cells. Benefits of NovActive® Proteins

Fully Active

-Fully folded naturally by eukaryotic source

-Comparable for eukaryotic glycosylation

BioRisk Free

-animal-free

-serum-free

-endotoxin-free

-infection reagent-free

-low in proteolyic activity

-low in pyrogenic and pro-inflammatory activity

Just reconstitute and add to your cell culture.

Have FDA G.R.A.S. (generally recognized as safe) approval.

Advantages of barley endosperm Folding -Proficient protein machinery, with eukaryotic folding, allows for native formation of the protein and long term protection and storage. Environment -A biochemically inert environment, void of endotoxins, low protease activity and secondary metabolite content, and a simple protein profile, aid in downstream processing in barley. FDA G.R.A.S status -Barley is recognized by the FDA as having G.R.A.S (generally recognized as safe) status.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LIF