LIF Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

LIF Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LIF.
  
  

  Source: E. coli

  Amino Acid Sequence: MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEK

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: LIF
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85717.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LIF Recombinant Protein Antigen

• CDF
• D Factor
• DIA
• differentiation inhibitory activity
• differentiation stimulating factor
• Differentiation-stimulating factor
• Emfilermin
• HILDA
• HILDAcholinergic differentiation factor
• leukemia inhibitory factor (cholinergic differentiation factor)
• leukemia inhibitory factor
• LIF
• Melanoma-derived LPL inhibitor
• MLPLI

Background

LIF (leukemia inhibitory factor, myeloid leukemia inhibitory factor) a pleiotropic lymphoid factor was initially described as a factor that inhibits the proliferation of myeloid leukemia cells and induces their differentiation into macrophages. Other activities of LIF include inhibition of adipogenesis, cholinergic neuron differentiation and bone metabolism. Human and mouse LIF share 78% homology and activities of LIF are not species-specific. Human LIF is active on mouse cells, but murine LIF is not active on human cells. Benefits of NovActive® Proteins

Fully Active

-Fully folded naturally by eukaryotic source

-Comparable for eukaryotic glycosylation

BioRisk Free

-animal-free

-serum-free

-endotoxin-free

-infection reagent-free

-low in proteolyic activity

-low in pyrogenic and pro-inflammatory activity

Just reconstitute and add to your cell culture.

Have FDA G.R.A.S. (generally recognized as safe) approval.

Advantages of barley endosperm Folding -Proficient protein machinery, with eukaryotic folding, allows for native formation of the protein and long term protection and storage. Environment -A biochemically inert environment, void of endotoxins, low protease activity and secondary metabolite content, and a simple protein profile, aid in downstream processing in barley. FDA G.R.A.S status -Barley is recognized by the FDA as having G.R.A.S (generally recognized as safe) status.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: LIF