LHR Antibody - BSA Free Summary
| Immunogen |
This antibody has been engineered to specifically recognize the recombinant protein LHR using the following amino acid sequence: SVTLKLYGNGFEEVQSHAFNGTTLTSLELKENVHLEKMHNGAFRGATGPKTLDISSTKLQALPSYGLESIQR |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
LHCGR |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
|
| Application Notes |
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for LHR Antibody - BSA Free
Background
LHCGR has been reported in brain, cervix, epididymis, ovary, placenta, prostate, testis, umbilical cord, and uterus. ESTs have been isolated from fetal lung/testis/B-cell and testis libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu, RM
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ICC, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Publications for LHR Antibody (NBP3-24955) (0)
There are no publications for LHR Antibody (NBP3-24955).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for LHR Antibody (NBP3-24955) (0)
There are no reviews for LHR Antibody (NBP3-24955).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for LHR Antibody (NBP3-24955) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional LHR Products
Research Areas for LHR Antibody (NBP3-24955)
Find related products by research area.
|
Blogs on LHR