LCMT1 Antibody


Western Blot: LCMT1 Antibody [NBP2-14188] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: LCMT1 Antibody [NBP2-14188] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: LCMT1 Antibody [NBP2-14188] - Staining of human testis shows nuclear and cytoplasmic positivity in cells in seminiferous ducts.
Western Blot: LCMT1 Antibody [NBP2-14188] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

LCMT1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RLLSNGWETASAVDMMELYNRLPRAEVSRIESLEFLDEMELLEQLMRHYC LCWATKGGNELGLKE
Specificity of human LCMT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LCMT1 Protein (NBP2-14188PEP)

Reactivity Notes

Highest antigen sequence identity to the following orthologs: Mouse ENSMUSG00000030763 (89%) Rat ENSRNOG00000014565 (89%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for LCMT1 Antibody

  • CGI-68
  • EC 2.1.1.-
  • LCMT
  • leucine carboxyl methyltransferase 1
  • PPMT1
  • protein phosphatase methyltransferase 1
  • Protein-leucine O-methyltransferase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC, IHC-P

Publications for LCMT1 Antibody (NBP2-14188) (0)

There are no publications for LCMT1 Antibody (NBP2-14188).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LCMT1 Antibody (NBP2-14188) (0)

There are no reviews for LCMT1 Antibody (NBP2-14188). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LCMT1 Antibody (NBP2-14188) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional LCMT1 Products

Bioinformatics Tool for LCMT1 Antibody (NBP2-14188)

Discover related pathways, diseases and genes to LCMT1 Antibody (NBP2-14188). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LCMT1 Antibody (NBP2-14188)

Discover more about diseases related to LCMT1 Antibody (NBP2-14188).

Pathways for LCMT1 Antibody (NBP2-14188)

View related products by pathway.

PTMs for LCMT1 Antibody (NBP2-14188)

Learn more about PTMs related to LCMT1 Antibody (NBP2-14188).

Blogs on LCMT1

There are no specific blogs for LCMT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LCMT1 Antibody and receive a gift card or discount.


Gene Symbol LCMT1