RCN1 Antibody

Images

 
Western Blot: RCN1 Antibody [NBP1-83483] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: RCN1 Antibody [NBP1-83483] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: RCN1 Antibody [NBP1-83483] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Western Blot: RCN1 Antibody [NBP1-83483] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RCN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RCN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RCN1 Protein (NBP1-83483PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RCN1 Antibody

  • FLJ37041
  • FLJ55835
  • PIG20
  • proliferation-inducing gene 20
  • RCAL
  • RCN
  • reticulocalbin 1, EF-hand calcium binding domain
  • reticulocalbin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46852
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-76995
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-32010
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP1-90348
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB110-68281
Species: Hu, Mu, Rt, Mk
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-84972
Species: Hu
Applications: WB, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56483
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-47284
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RCN1 Antibody (NBP1-83483) (0)

There are no publications for RCN1 Antibody (NBP1-83483).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RCN1 Antibody (NBP1-83483) (0)

There are no reviews for RCN1 Antibody (NBP1-83483). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RCN1 Antibody (NBP1-83483) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RCN1 Products

Bioinformatics Tool for RCN1 Antibody (NBP1-83483)

Discover related pathways, diseases and genes to RCN1 Antibody (NBP1-83483). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RCN1 Antibody (NBP1-83483)

Discover more about diseases related to RCN1 Antibody (NBP1-83483).
 

Pathways for RCN1 Antibody (NBP1-83483)

View related products by pathway.

PTMs for RCN1 Antibody (NBP1-83483)

Learn more about PTMs related to RCN1 Antibody (NBP1-83483).
 

Research Areas for RCN1 Antibody (NBP1-83483)

Find related products by research area.

Blogs on RCN1

There are no specific blogs for RCN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RCN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RCN1