ARHGAP17 Antibody


Western Blot: ARHGAP17 Antibody [NBP1-83870] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: ARHGAP17 Antibody [NBP1-83870] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: ARHGAP17 Antibody [NBP1-83870] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

ARHGAP17 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KQLARLVLDWDSVRARWNQAHKSSGTNFQGLPSKIDTLKEEMDEAGNKVEQCKDQLAADMYNFMAKEGEYGKFFVTLLEA
Specificity of human, mouse, rat ARHGAP17 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARHGAP17 Protein (NBP1-83870PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ARHGAP17 Antibody

  • DKFZp564A1363
  • FLJ10308
  • FLJ13219
  • FLJ37567
  • FLJ43368
  • MGC87805
  • MST110
  • MSTP038
  • MSTP066
  • MSTP110
  • neuron-associated developmentally regulated protein
  • PP367
  • PP4534
  • Rho GTPase activating protein 17
  • rho GTPase-activating protein 17
  • RhoGAP interacting with CIP4 homologs 1
  • RhoGAP interacting with CIP4 homologs protein 1
  • Rho-type GTPase-activating protein 17
  • RICH-1
  • RICH1B
  • RICH1MST066
  • WBP15


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ARHGAP17 Antibody (NBP1-83870) (0)

There are no publications for ARHGAP17 Antibody (NBP1-83870).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGAP17 Antibody (NBP1-83870) (0)

There are no reviews for ARHGAP17 Antibody (NBP1-83870). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARHGAP17 Antibody (NBP1-83870) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ARHGAP17 Products

Bioinformatics Tool for ARHGAP17 Antibody (NBP1-83870)

Discover related pathways, diseases and genes to ARHGAP17 Antibody (NBP1-83870). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGAP17 Antibody (NBP1-83870)

Discover more about diseases related to ARHGAP17 Antibody (NBP1-83870).

Pathways for ARHGAP17 Antibody (NBP1-83870)

View related products by pathway.

PTMs for ARHGAP17 Antibody (NBP1-83870)

Learn more about PTMs related to ARHGAP17 Antibody (NBP1-83870).

Blogs on ARHGAP17

There are no specific blogs for ARHGAP17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ARHGAP17 Antibody and receive a gift card or discount.


Gene Symbol ARHGAP17