ARHGAP17 Antibody

Images

 
Western Blot: ARHGAP17 Antibody [NBP1-83870] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: ARHGAP17 Antibody [NBP1-83870] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: ARHGAP17 Antibody [NBP1-83870] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: ARHGAP17 Antibody [NBP1-83870] -Staining of human tonsil shows moderate cytoplasmic positivity in germinal and non-germinal center cells.
Immunohistochemistry-Paraffin: ARHGAP17 Antibody [NBP1-83870] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ARHGAP17 Antibody [NBP1-83870] - Staining of human pancreas shows very weak cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARHGAP17 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KQLARLVLDWDSVRARWNQAHKSSGTNFQGLPSKIDTLKEEMDEAGNKVEQCKDQLAADMYNFMAKEGEYGKFFVTLLEA
Predicted Species
Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGAP17
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARHGAP17 Protein (NBP1-83870PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARHGAP17 Antibody

  • DKFZp564A1363
  • FLJ10308
  • FLJ13219
  • FLJ37567
  • FLJ43368
  • MGC87805
  • MST110
  • MSTP038
  • MSTP066
  • MSTP110
  • NADRIN
  • neuron-associated developmentally regulated protein
  • PP367
  • PP4534
  • Rho GTPase activating protein 17
  • rho GTPase-activating protein 17
  • RhoGAP interacting with CIP4 homologs 1
  • RhoGAP interacting with CIP4 homologs protein 1
  • Rho-type GTPase-activating protein 17
  • RICH-1
  • RICH1B
  • RICH1MST066
  • WBP15

Background

RICH1 is a GTPase-activating protein (GAP). GAPs stimulate the intrinsic GTP hydrolysis of small G proteins, such as RHOA (MIM 165390), RAC1 (MIM 602048), and CDC42 (MIM 116952).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ARHGAP17 Antibody (NBP1-83870) (0)

There are no publications for ARHGAP17 Antibody (NBP1-83870).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGAP17 Antibody (NBP1-83870) (0)

There are no reviews for ARHGAP17 Antibody (NBP1-83870). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARHGAP17 Antibody (NBP1-83870) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGAP17 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP17
Entrez
Uniprot