LCLAT1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: LCLAT1 Antibody [NBP1-89204] - Staining of human cell line A-431 shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: LCLAT1 Antibody [NBP1-89204] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: LCLAT1 Antibody [NBP1-89204] - Staining of human fallopian tube shows weak to cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: LCLAT1 Antibody [NBP1-89204] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: LCLAT1 Antibody [NBP1-89204] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LCLAT1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LHPRTTGFTFVVDRLREGKNLDAVHDITVAYPHNIPQSEKHLLQGDFPREIHFHVHRYPIDTLPTSKEDLQLWCHKR
• Predicted Species: Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LCLAT1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LCLAT1 Protein (NBP1-89204PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LCLAT1 Antibody - BSA Free

• 1-acylglycerol-3-phosphate O-acyltransferase 8
• 1-AGPAT 8
• Acyl-CoA:lysocardiolipin acyltransferase 1
• AGPAT8lysocardiolipin acyltransferase
• ALCAT11AGPAT8
• EC 2.3.1.-
• EC 2.3.1.51
• FLJ37965
• HSRG1849
• LYCAT
• lysocardiolipin acyltransferase 1
• UNQ1849,1-AGP acyltransferase 8

Background

Acyl-CoA:lysocardiolipin acyltransferase. Possesses both lysophosphatidylinositol acyltransferase (LPIAT) andlysophosphatidylglycerol acyltransferase (LPGAT) activities. Recognizes both monolysocardiolipin and dilysocardiolipinas substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. Acts as a remodeling enzyme forcardiolipin, a major membrane polyglycerophospholipid. Converts lysophosphatidic acid (LPA) into phosphatidic acid(PA) with a relatively low activity. Required for establishment of the hematopoietic and endothelial lineages

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LCLAT1