LPGAT1 Antibody

Images

 
Western Blot: LPGAT1 Antibody [NBP1-83929] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: LPGAT1 Antibody [NBP1-83929] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LPGAT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ETSQAFAKKNNLPFLTNVTLPRSGATKIILNALVAQQKNGSPAGGDAKELDSKSKGLQWIIDTTIAYPKAEPIDIQTWILGYRKPTVTHVHYRIFPIKDVPLETDDLTTWLYQRFVEKEDLLSHFYETGAFPPSKGHKEAVSREMT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LPGAT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LPGAT1 Protein (NBP1-83929PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LPGAT1 Antibody

  • acyl-CoA:lysophosphatidylglycerol acyltransferase 1
  • EC 2.3.1.-
  • FAM34A
  • FAM34A1
  • family with sequence similarity 34, member A
  • KIAA0205
  • lysophosphatidylglycerol acyltransferase 1
  • NET8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-27464
Species: Hu
Applications: WB, PEP-ELISA
NBP2-49207
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00009056-B01P
Species: Hu, Rt
Applications: WB
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
AF5789
Species: Hu, Mu, Rt
Applications: WB
NBP1-84935
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46622
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-41412
Species: Hu, Mu
Applications: WB, IP
NB100-2564
Species: Hu
Applications: WB
NB200-412
Species: Hu, Mu, Rt, Ca
Applications: IA, S-ELISA
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83929
Species: Hu
Applications: WB, IHC, IHC-P

Publications for LPGAT1 Antibody (NBP1-83929) (0)

There are no publications for LPGAT1 Antibody (NBP1-83929).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LPGAT1 Antibody (NBP1-83929) (0)

There are no reviews for LPGAT1 Antibody (NBP1-83929). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LPGAT1 Antibody (NBP1-83929) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LPGAT1 Products

Bioinformatics Tool for LPGAT1 Antibody (NBP1-83929)

Discover related pathways, diseases and genes to LPGAT1 Antibody (NBP1-83929). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for LPGAT1 Antibody (NBP1-83929)

View related products by pathway.

PTMs for LPGAT1 Antibody (NBP1-83929)

Learn more about PTMs related to LPGAT1 Antibody (NBP1-83929).
 

Research Areas for LPGAT1 Antibody (NBP1-83929)

Find related products by research area.

Blogs on LPGAT1

There are no specific blogs for LPGAT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LPGAT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LPGAT1