LPGAT1 Antibody

Images

 
Immunohistochemistry-Paraffin: LPGAT1 Antibody [NBP1-83929] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: LPGAT1 Antibody [NBP1-83929] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: LPGAT1 Antibody [NBP1-83929] - Staining of human upper gastrointestinal tract shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: LPGAT1 Antibody [NBP1-83929] - Staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LPGAT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ETSQAFAKKNNLPFLTNVTLPRSGATKIILNALVAQQKNGSPAGGDAKELDSKSKGLQWIIDTTIAYPKAEPIDIQTWILGYRKPTVTHVHYRIFPIKDVPLETDDLTTWLYQRFVEKEDLLSHFYETGAFPPSKGHKEAVSREMT
Specificity
Specificity of human LPGAT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LPGAT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
LPGAT1 Knockout HeLa Cell Lysate
Control Peptide
LPGAT1 Protein (NBP1-83929PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LPGAT1 Antibody

  • acyl-CoA:lysophosphatidylglycerol acyltransferase 1
  • EC 2.3.1.-
  • FAM34A
  • FAM34A1
  • family with sequence similarity 34, member A
  • KIAA0205
  • lysophosphatidylglycerol acyltransferase 1
  • NET8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, Gp, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-27464
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-49207
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-25255
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-82826
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00003059-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PLA, RNAi, S-ELISA
NBP1-84935
Species: Hu
Applications: IHC, IHC-P
NBP2-59478
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46622
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-847
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-2564
Species: Hu
Applications: WB
H00002629-M01
Species: Hu, Pl
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-67117
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-83929
Species: Hu
Applications: IHC, IHC-P

Publications for LPGAT1 Antibody (NBP1-83929) (0)

There are no publications for LPGAT1 Antibody (NBP1-83929).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LPGAT1 Antibody (NBP1-83929) (0)

There are no reviews for LPGAT1 Antibody (NBP1-83929). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LPGAT1 Antibody (NBP1-83929) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LPGAT1 Products

Bioinformatics Tool for LPGAT1 Antibody (NBP1-83929)

Discover related pathways, diseases and genes to LPGAT1 Antibody (NBP1-83929). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for LPGAT1 Antibody (NBP1-83929)

View related products by pathway.

PTMs for LPGAT1 Antibody (NBP1-83929)

Learn more about PTMs related to LPGAT1 Antibody (NBP1-83929).
 

Research Areas for LPGAT1 Antibody (NBP1-83929)

Find related products by research area.

Blogs on LPGAT1

There are no specific blogs for LPGAT1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LPGAT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LPGAT1