Lck Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Lck Antibody [NBP1-85804] - Staining of human cell line A-431 shows localization to the Golgi apparatus. Antibody staining is shown in green.

Staining of human duodenum shows strong membranous/cytoplasmic membranous positivity in lymphoid cells.

Staining of human cerebral cortex shows no positivity in neurons as expected.

Staining of human tonsil shows strong membranous/cytoplasmic membranous positivity in non-germinal center cells and germinal center cells.

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue

Immunohistochemistry analysis in human tonsil and pancreas tissues using HPA003494 antibody. Corresponding LCK RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Lck Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Lck Antibody - BSA Free (NBP1-85804) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Lck Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLEPEPWFFKNLSRKDAERQLLAPGNTHGS
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LCK
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Lck Recombinant Protein Antigen (NBP1-85804PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Lck Antibody - BSA Free

• EC 2.7.10
• EC 2.7.10.2
• Hck-3
• Lck
• Lcktkr
• Leukocyte C-terminal Src kinase
• LSK
• LSTRA
• Lymphocyte cell-specific protein-tyrosine kinase
• lymphocyte-specific protein tyrosine kinase
• p56(LSTRA) protein-tyrosine kinase
• p56lck
• p56-LCK
• pp58lck
• Protein YT16
• Proto-oncogene Lck
• proto-oncogene tyrosine-protein kinase LCK
• T cell-specific protein-tyrosine kinase
• T-lymphocyte specific protein tyrosine kinase p56lck
• tyrosine-protein kinase Lck
• YT16

Background

The human T-cell or lymphocyte specific gene Lck/p56 is a member of the Src family of non-receptors tyrosine kinase. Mostly expressed in T cells, Lck has been shown to be critical for the normal development of T lymphocytes (1). Additionally, the N-terminal region of the tyrosine kinase Lck interacts with the cytoplasmic domains of CD4 and CD8 (2). Autophosphorylation at Tyr-394 appears to be required for maximum catalytic activity (3) but it can also be suppressed by phosphorylation of the carboxyl-terminal tyrosine Tyr-505 (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Lck Antibody (NBP1-85804)(1)

Publication using NBP1-85804

• Porciello N, Cipria D, Masi G et al. Role of the membrane anchor in the regulation of Lck activity The Journal of biological chemistry 2022-11-10 [PMID: 36372231] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: LCK