PSMC1 Antibody

Images

 
Western Blot: PSMC1 Antibody [NBP1-80959] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunocytochemistry/ Immunofluorescence: PSMC1 Antibody [NBP1-80959] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Western Blot: PSMC1 Antibody [NBP1-80959] - Analysis in human cell line EFO-21.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PSMC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPE
Specificity
Specificity of human, mouse, rat PSMC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
PSMC1 Protein (NBP1-80959PEP)
Publications
Read Publication using
NBP1-80959 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25255805).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PSMC1 Antibody

  • 26S protease regulatory subunit 4
  • 26S proteasome AAA-ATPase subunit RPT2
  • MGC24583
  • P26S4
  • p56
  • proteasome (prosome, macropain) 26S subunit, ATPase, 1
  • proteasome 26S ATPase subunit 1
  • Proteasome 26S subunit ATPase 1
  • proteasome 26S subunit, ATPase, 1
  • S4MGC8541

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP1-85804
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-345
Species: Hu
Applications: WB, ChIP, IP
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
H00006202-Q01
Species: Hu
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-58885
Species: Hu
Applications: WB, ICC/IF
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22298
Species: Hu, Mu
Applications: IP (-), WB, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS

Publications for PSMC1 Antibody (NBP1-80959)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PSMC1 Antibody (NBP1-80959) (0)

There are no reviews for PSMC1 Antibody (NBP1-80959). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PSMC1 Antibody (NBP1-80959) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PSMC1 Antibody (NBP1-80959)

Discover related pathways, diseases and genes to PSMC1 Antibody (NBP1-80959). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSMC1 Antibody (NBP1-80959)

Discover more about diseases related to PSMC1 Antibody (NBP1-80959).
 

Pathways for PSMC1 Antibody (NBP1-80959)

View related products by pathway.

PTMs for PSMC1 Antibody (NBP1-80959)

Learn more about PTMs related to PSMC1 Antibody (NBP1-80959).

Blogs on PSMC1

There are no specific blogs for PSMC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSMC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMC1
Entrez
Uniprot