Latexin Antibody

Images

 
Western Blot: Latexin Antibody [NBP1-86079] - Analysis in human cell line MCF-7.
Immunocytochemistry/ Immunofluorescence: Latexin Antibody [NBP1-86079] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Latexin Antibody [NBP1-86079] - Staining of human prostate shows strong cytoplasmic and nuclear positivity in glandular cells.
Genetic Strategies: Western Blot: Latexin Antibody [NBP1-86079] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LXN antibody. Remaining relative ...read more
Western Blot: Latexin Antibody [NBP1-86079] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

Latexin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYHLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTF
Specificity
Specificity of human Latexin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LXN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
Latexin Knockout HeLa Cell Lysate
Control Peptide
Latexin Protein (NBP1-86079PEP)
Publications
Read Publication using NBP1-86079.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23364479)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Latexin Antibody

  • ECI
  • ECIMUM
  • Endogenous carboxypeptidase inhibitor
  • Latexin
  • LXN
  • TCI
  • TCIProtein MUM
  • Tissue carboxypeptidase inhibitor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-1892
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF7895
Species: Hu
Applications: WB, IHC
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-92717
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85466
Species: Hu, Mu, Fe
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-47842
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IP

Publications for Latexin Antibody (NBP1-86079)(1)

Reviews for Latexin Antibody (NBP1-86079) (0)

There are no reviews for Latexin Antibody (NBP1-86079). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Latexin Antibody (NBP1-86079) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Latexin Products

Bioinformatics Tool for Latexin Antibody (NBP1-86079)

Discover related pathways, diseases and genes to Latexin Antibody (NBP1-86079). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Latexin Antibody (NBP1-86079)

Discover more about diseases related to Latexin Antibody (NBP1-86079).
 

Pathways for Latexin Antibody (NBP1-86079)

View related products by pathway.

PTMs for Latexin Antibody (NBP1-86079)

Learn more about PTMs related to Latexin Antibody (NBP1-86079).
 

Research Areas for Latexin Antibody (NBP1-86079)

Find related products by research area.

Blogs on Latexin.

Chromatin reader domains of DNMT-targeting protein, UHRF1, are responsible for cancerous DNA hypermethylation
By Jamshed Arslan, Pharm. D., PhD. DNA methylation represses transcription of many genes, including tumor suppressor genes. A protein called UHRF1 recruits DNA methyltransferases (DNMTs) to establish and maintain DNA...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Latexin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LXN