LANPL Antibody - Azide and BSA Free

Western Blot: LANPL Antibody [NBP3-15536] - Western blot analysis of extracts of various cell lines, using LANPL Rabbit pAb (NBP3-15536) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

LANPL Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit LANPL Antibody - Azide and BSA Free (NBP3-15536) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human LANPL (NP_112182.1). MEMKKKINLELRNRSPEEVTELVLDNCLCVNGEIEGLNDTFKELEFLSMANVELSSLARLPSLNKLRKLE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANP32E
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for LANPL Antibody - Azide and BSA Free

• acidic (leucine-rich) nuclear phosphoprotein 32 family, member E
• LANP-like protein
• LANP-LLANPLacidic leucine-rich nuclear phosphoprotein 32 family member E
• leucine-rich acidic nuclear protein like
• MGC5350

Background

Apoptosis is related to many diseases and development. Caspase-9 plays a central role in cell death induced by a variety of apoptosis activators. Cytochrome c, after released from mitochondria, binds to Apaf-1, which forms an apoptosome that in turn binds to and activate procaspase-9. Activated caspase-9 cleaves and activates the effector caspases (caspase-3, -6 and

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: ANP32E