Laminin S/Laminin beta 2 Antibody - BSA Free

Western Blot: Laminin S/Laminin beta 2 Antibody [NBP1-87717] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunohistochemistry-Paraffin: Laminin S/Laminin beta 2 Antibody [NBP1-87717] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: Laminin S/Laminin beta 2 Antibody [NBP1-87717] - Staining of human heart muscle shows weak to moderate membranous positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: Laminin S/Laminin beta 2 Antibody [NBP1-87717] - Staining of human kidney shows weak to moderate membranous positivity in cells in glomeruli.

Immunohistochemistry-Paraffin: Laminin S/Laminin beta 2 Antibody [NBP1-87717] - Staining of human cerebral cortex shows moderate membranous positivity in endothelial cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Laminin S/Laminin beta 2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Laminin S/Laminin beta 2 Antibody - BSA Free (NBP1-87717) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DLTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDLLKHSNFLGAYDSIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFNSKHMANQRALGKLSAHTHTLSLTDINELVCGAPG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LAMB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Laminin S/Laminin beta 2 Protein (NBP1-87717PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (82%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Laminin S/Laminin beta 2 Antibody - BSA Free

• LAMB2
• Laminin B1s chain
• Laminin beta 2
• Laminin S
• laminin subunit beta-2
• laminin, beta 2 (laminin S)
• Laminin-11 subunit beta
• Laminin-14 subunit beta
• Laminin-15 subunit beta
• Laminin-3 subunit beta
• Laminin-4 subunit beta
• Laminin-7 subunit beta
• LAMSLaminin-9 subunit beta
• S-LAM beta
• S-laminin subunit beta

Background

The Laminins comprise a growing family of disulfide-linked heterotrimers consisting of three genetically distinct polypeptide chains, designated alpha, beta and gamma. A major component of the basal lamina, Laminins play a crucial role in providing a scaffolding upon which tissues are assembled and which serves as a physical barrier separating specialized tissues. During embryogenesis and early development, cells migrate along basement membranes, which are required for the polarization of cells. The beta-2 laminin chain plays a role in melanoma spread, promoting tumor migration along the abluminal surface of vessel, a phenomenon which has been termed extra-vascular migratory metastasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LAMB2