Laminin S/Laminin beta 2 Antibody

Images

 
Western Blot: Laminin beta 2 Antibody [NBP1-87717] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431. Lane 5: ...read more
Immunohistochemistry-Paraffin: Laminin beta 2 Antibody [NBP1-87717] - Staining of human heart muscle shows distinct membranous positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Laminin S/Laminin beta 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DLTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDLLKHSNFLGAYDSIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFNSKHMANQRALGKLSAHTHTLSLTDINELVCGAPG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LAMB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Laminin S/Laminin beta 2 Protein (NBP1-87717PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Laminin S/Laminin beta 2 Antibody

  • LAMB2
  • Laminin B1s chain
  • Laminin beta 2
  • Laminin S
  • laminin subunit beta-2
  • laminin, beta 2 (laminin S)
  • Laminin-11 subunit beta
  • Laminin-14 subunit beta
  • Laminin-15 subunit beta
  • Laminin-3 subunit beta
  • Laminin-4 subunit beta
  • Laminin-7 subunit beta
  • LAMSLaminin-9 subunit beta
  • S-LAM beta
  • S-laminin subunit beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3159
Species: Mu
Applications: WB, IHC
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
MAB6240
Species: Hu
Applications: WB, IHC
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-89818
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1265
Species: Mu
Applications: WB, IP, Neut
NBP1-92275
Species: Hu
Applications: IHC, IHC-P
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-04611
Species: Hu
MAB4077
Species: Hu
Applications: WB, IHC
AF550
Species: Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)

Publications for Laminin S/Laminin beta 2 Antibody (NBP1-87717) (0)

There are no publications for Laminin S/Laminin beta 2 Antibody (NBP1-87717).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Laminin S/Laminin beta 2 Antibody (NBP1-87717) (0)

There are no reviews for Laminin S/Laminin beta 2 Antibody (NBP1-87717). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Laminin S/Laminin beta 2 Antibody (NBP1-87717) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Laminin S/Laminin beta 2 Products

Bioinformatics Tool for Laminin S/Laminin beta 2 Antibody (NBP1-87717)

Discover related pathways, diseases and genes to Laminin S/Laminin beta 2 Antibody (NBP1-87717). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Laminin S/Laminin beta 2 Antibody (NBP1-87717)

Discover more about diseases related to Laminin S/Laminin beta 2 Antibody (NBP1-87717).
 

Pathways for Laminin S/Laminin beta 2 Antibody (NBP1-87717)

View related products by pathway.

PTMs for Laminin S/Laminin beta 2 Antibody (NBP1-87717)

Learn more about PTMs related to Laminin S/Laminin beta 2 Antibody (NBP1-87717).

Blogs on Laminin S/Laminin beta 2

There are no specific blogs for Laminin S/Laminin beta 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Laminin S/Laminin beta 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMB2
Entrez