Home » Laminin alpha 5 » Laminin alpha 5 Antibodies » Laminin alpha 5 Antibody (CL3118)

Laminin alpha 5 Antibody (CL3118)

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Laminin alpha 5 Antibody (CL3118) [NBP2-42391] - Analysis in human placenta tissue.
Western Blot: Laminin alpha 5 Antibody (CL3118) [NBP2-42391] - Analysis in human placenta tissue.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Laminin alpha 5 Antibody (CL3118) [NBP2-42391] - Staining in human placenta and lymph node tissues. Corresponding LAMA5 RNA-seq data are presented for the ...read more
Western Blot: Laminin alpha 5 Antibody (CL3118) [NBP2-42391] - Analysis of purified human recombinant Laminin-511, Laminin-521, Laminin-121, Laminin-221, Laminin-332 and Laminin-411.
Genetic Strategies: Western Blot: Laminin alpha 5 Antibody (CL3118) [NBP2-42391] - Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LAMA5 antibody. ...read more
Immunohistochemistry-Paraffin: Laminin alpha 5 Antibody (CL3118) [NBP2-42391] - Staining of human kidney shows strong membranous positivity in glomeruli, as well as in basement membrane of renal tubules.
Immunohistochemistry-Paraffin: Laminin alpha 5 Antibody (CL3118) [NBP2-42391] - Staining of human placenta shows moderate positivity in basement membrane of trophoblastic cells.
Immunohistochemistry-Paraffin: Laminin alpha 5 Antibody (CL3118) [NBP2-42391] - Staining of human colon shows moderate positivity in basement membrane of glandular cells.
Immunohistochemistry-Paraffin: Laminin alpha 5 Antibody (CL3118) [NBP2-42391] - Staining of human lymph node shows no positivity in lymphoid cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P, KD
Clone
CL3118
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

  

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Laminin alpha 5 Antibody (CL3118) Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LNLSSIILDVNQDRLTQRAIEASNAYSRILQAVQAAEDAAGQALQQADHTWATVVRQGLVDRAQQLLANSTALEEAMLQEQQRLGLVWAAL
Epitope
RQGLVDRAQQ
Specificity
Specificity of human Laminin alpha 5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
LAMA5
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
Laminin alpha 5 Knockout HeLa Cell Lysate
Publications
Read Publications using
NBP2-42391 in the following applications:

  • IHC-P
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Laminin alpha 5 Antibody (CL3118)

  • KIAA0533
  • KIAA1907
  • laminin alpha-5 chain
  • laminin subunit alpha-5
  • laminin, alpha 5
  • Laminin-10 subunit alpha
  • Laminin-11 subunit alpha
  • Laminin-15 subunit alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Laminin Antibody
NB300-144
Immunohistochemistry Free-Floating: Laminin Antibody [NB300-144] - Immunohistological analysis of brain stem section stained with rabbit pAb to laminin, NB300-144, dilution 1:1,000 in red, and costained with chicken pAb to Myelin Basic Protein (MBP), dilution 1:5,000 in green. The blue is DAPI staining of nuclear DNA. Following transcardial perfusion of rat with 4% paraformaldehyde, brain was post fixed for 24 hours, cut to 45 uM, and free-floating sections were stained with the above antibodies. The laminin antibody is an excellent marker of basement membranes surrounding blood vessels, while the MBP antibody stains the myelin sheathes around axons.
Immunohistochemistry: Laminin Antibody [NB300-144] - MxIF analysis of mouse submandibular salivary gland morphogenesis. MxIF of a developmental TMA including embryonic stages (E14, E16, E18) and postnatal stages (P5 and P20) was performed using sequential application of directly conjugated antibodies to detect multiple markers of tissue structures and cell types on the same tissue sections. Tissue compartments. The epithelium, mesenchyme, neurons, and basement membranes was detected using antibodies directed towards E-cadherin (ECAD, red), platelet-derived growth factor (PDGFR, green), beta III tubulin (bIII, magenta), and laminin (LMN, cyan), respectively. Image collected and cropped by CiteAb from the following publication (http://bio.biologists.org/cgi/doi/10.1242/bio.20134309), licensed under a CC-BY licence.
Immunohistochemistry Free-Floating: Laminin Antibody [NB300-144] - Staining of mouse section of cortex stained with Laminin (red). Blue is DAPI staining of DNA. This antibody reveals strong staining in the basement membranes of blood vessels.
(8 Reviews)
(62 Publications)
Species: Hu, Mu, Rt, ChHa, In, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
Sonic Hedgehog/Shh
[Unconjugated]
1845-SH
1 μg/lane of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 22 kDa.
MALDI-TOF analysis of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus. The major peak corresponds to the calculated molecular mass, 19814 Da. The minor peak at 20029  is a matrix-associated artifact of the MALDI-TOF.
Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus (Catalog # 1845-SH) induces alkaline phosphatase production by the C3H10T1/2 mouse embryonic fibroblast cell line. The ED50 for this effect is 0.1‑0.4 μg/mL.
(5 Reviews)
(34 Publications)
Species: Hu
SLC7A5/LAT1
Antibody (BU53)
NBP2-50465
Flow (Cell Surface): SLC7A5/LAT1 Antibody (BU53) [NBP2-50465] - A cell surface stain was performed on Raji cells with SLC7A5 (BU53) antibody NBP2-50465AF647 (blue) along with a matched isotype control NB600-986AF647 (orange). Cells were incubated in an antibody dilution of 1 ug/mL for 20 minutes at RT. Both antibodies were conjugated to Alexa Fluor 647.
Flow (Cell Surface): SLC7A5/LAT1 Antibody (BU53) [NBP2-50465] - A cell surface stain was performed on Raji cells with SLC7A5 (BU53) antibody NBP2-50465 (blue) along with a matched isotype control NB600-986 (orange). Cells were incubated in an antibody dilution of 1 ug/mL for 20 minutes at RT, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody (F0101B, R&D Systems).
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
Alpha Actinin 4
Antibody (4D10)
H00000081-M01
Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01] - ACTN4 monoclonal antibody (M01), clone 4D10. Analysis of ACTN4 expression in NIH/3T3.
Immunocytochemistry/Immunofluorescence: Alpha Actinin 4 Antibody (4D10) [H00000081-M01] - Analysis of monoclonal antibody to ACTN4 on HeLa cell. Antibody concentration 20 ug/ml.
Immunohistochemistry-Paraffin: Alpha Actinin 4 Antibody (4D10) [H00000081-M01] - Analysis of monoclonal antibody to ACTN4 on formalin-fixed paraffin-embedded human lung adenocarcinoma. Antibody concentration 3 ug/ml.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Lamin B2 Antibody
(2E2F4)
NBP2-61818
Western Blot: Lamin B2 Antibody (2E2F4) [NBP2-61818] - Analysis using LMNB2 mAb against HEK293 (1) and LMNB2 (AA: 401-600)-hIgGFc transfected HEK293 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: Lamin B2 Antibody (2E2F4) [NBP2-61818] - Analysis of HepG2 cells using LMNB2 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin. Goat anti-Mouse IgG (H+L) DyLight 488 secondary antibody was used.
Immunohistochemistry-Paraffin: Lamin B2 Antibody (2E2F4) [NBP2-61818] - Analysis of ovarian cancer tissues using LMNB2 mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Integrin beta
1/CD29 Antibody (P4C1
NBP2-36561
Immunocytochemistry/Immunofluorescence: Integrin beta 1/CD29 Antibody (P4C10) [NBP2-36561] - Integrin beta 1 (P4C10) antibody was tested in -20 degree MeOH fixed HeLa cells at a 1:200 dilution against DyLight 488 (green). Actin and nuclei were counterstained against Phalloidin 568 (red) and DAPI (blue), respectively.
Flow Cytometry: Integrin beta 1/CD29 Antibody (P4C10) [NBP2-36561] - An intracellular stain was performed on A431 cells with Integrin beta 1/CD29 [P4C10] Antibody NBP2-36561B (blue) and a matched isotype control (orange). Both antibodies were conjugated to Biotin. Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Streptavidin - R-Phycoerythrin Protein (2012-1000, Novus Biologicals).
Flow Cytometry: Integrin beta 1/CD29 Antibody (P4C10) [NBP2-36561]
(10 Publications)
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, B/N
Laminin gamma 1
Antibody (A5)
NBP2-44751
Immunohistochemistry-Paraffin: Laminin gamma 1 Antibody (A5) [NBP2-44751] - Human Renal Cell Carcinoma stained with Laminin Monoclonal Antibody (A5).
Immunohistochemistry-Frozen: Laminin gamma 1 Antibody (A5) [NBP2-44751] - Bovine frozen skeletal muscle section was fixed in 4% PFA for 5 min and stained with anti-laminin antibody (NBP2-44751) overnight at 4 C and then stained with a goat anti-rat-Alexa Fluor 488 secondary antibody (green) for 1 hour at room temperature. Section was then mounted in a mounting medium containing Dapi (blue). Image from verified customer review.
Immunohistochemistry-Paraffin: Laminin gamma 1 Antibody (A5) [NBP2-44751] - Formalin-fixed, paraffin-embedded human Renal Cell Carcinoma stained with Laminin gamma 1 Antibody (A5).
(1 Review)
(3 Publications)
Species: Hu, Mu, Bv
Applications: Flow, IHC, IHC-Fr, IHC-P, IF
Integrin alpha
3/CD49c Antibody [Unc ...
AF2787
Integrin alpha 3/CD49c Antibody [Unconjugated]
(6 Publications)
Species: Mu
Applications: WB, Flow, CyTOF-ready
Laminin S/Laminin
beta 2 Antibody (C4) ...
MAB2066
Laminin S was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Mouse Anti-Human/Rat/Chicken Laminin S Monoclonal Antibody (Catalog # MAB2066) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 493-conjugated Anti-Mouse IgG Secondary Antibody (green; Catalog # NL009) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(2 Publications)
Species: Hu, Rt, Ch
Applications: WB, IP, ICC
PKC mu Antibody
H00005587-B01P
Western Blot: PKC mu Antibody [H00005587-B01P] - Analysis of PRKD1 expression in transfected 293T cell line by PRKD1 polyclonal antibody. Lane 1: PRKD1 transfected lysate(100.32 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: PKC mu Antibody [H00005587-B01P] - Analysis of purified antibody to PRKD1 on HeLa cell. (antibody concentration 10 ug/ml)
(1 Publication)
Species: Hu
Applications: WB, ICC/IF
Laminin alpha 4
Antibody [Unconjugate
AF3837
Laminin  alpha 4 was detected in immersion fixed frozen sections of mouse embryo (13 d.p.c.) using Goat Anti-Mouse Laminin  alpha 4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3837) at 3 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to membranes in blood vessels in CNS. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(1 Review)
(6 Publications)
Species: Mu
Applications: WB, IHC
PSMC6 Antibody
NBP2-19985
Western Blot: PSMC6 Antibody [NBP2-19985] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 10% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: PSMC6 Antibody [NBP2-19985] - Analysis of paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: PSMC6 Antibody [NBP2-19985] - Immunohistochemical analysis of paraffin-embedded HeLa xenograft, using antibody at 1:500 dilution.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
HES-1 Antibody
(OTI4H1)
NBP1-47791
Western Blot: HES-1 Antibody (OTI4H1) [NBP1-47791] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY HES1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-HES1 (1:500).
Immunocytochemistry/Immunofluorescence: HES-1 Antibody (OTI4H1) [NBP1-47791] - HeLa cells using anti-HES1 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: HES-1 Antibody (OTI4H1) [NBP1-47791] - Staining of paraffin-embedded liver using anti-Hes1 mouse monoclonal antibody.
(6 Publications)
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
MRG-binding
protein Antibody
NBP1-84936
Western Blot: MRG-binding protein Antibody [NBP1-84936] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-352
Immunocytochemistry/Immunofluorescence: MRG-binding protein Antibody [NBP1-84936] - Staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry-Paraffin: MRG-binding protein Antibody [NBP1-84936] - Staining in human testis and endometrium tissues using anti-MRGBP antibody. Corresponding MRGBP RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Fatty Acid
Synthase/FASN Antibod
NB400-114
Western Blot: Fatty Acid Synthase Antibody [NB400-114] - Expression of Fatty Acid Synthase in chicken hypothalamus. A: total RNA (1 ug) isolated from different tissues (brain, hypothalamus, liver and muscle) was subjected to RT-PCR using specific primers for chicken Fatty Acid Synthase (GenBank accession JO4485) or ribosomal 18S as a control (GenBank accession AF173612) B: tissue lysates (brain, hypothalmus, liver and muscle) were subjected to Western blot as described in MATERIALS AND METHODS. Blots were incubated with anti-Fatty Acid Synthase antibody and revealed by enhanced chemiluminescence. Picture compliments of Dridi S. et al, Am J Physiol Regul Integr Comp Physiol. 2006 Jul;291(1):R138-47. Epub 2006 Feb 2.
Immunocytochemistry/Immunofluorescence: Fatty Acid Synthase Antibody [NB400-114] - The Fas antibody was tested in MCF-7 cells at a 1:2000 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 550 (Red) and DAPI (Blue), respectively.
Immunohistochemistry-Paraffin: Fatty Acid Synthase Antibody [NB400-114] - Immunohistochemical localization of FAS in chicken hypothalmus. Paraffin sections were obtained from 3-wk-old broiler chickens.
(2 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
FATP5/SLC27A5
Antibody (9C4D1)
NBP2-37412
Western Blot: FATP5/SLC27A5 Antibody (9C4D1) [NBP2-37412] - Analysis using SLC27A5 mouse mAb against 3T3L1 (1), HepG2 (2), NIH3T3 (3), and PC-3 (4) cell lysate.
Immunohistochemistry-Paraffin: FATP5/SLC27A5 Antibody (9C4D1) [NBP2-37412] - Analysis of cervical cancer tissues using SLC27A5 mouse mAb with DAB staining.
Western Blot: FATP5/SLC27A5 Antibody (9C4D1) [NBP2-37412] - Analysis using SLC27A5 mAb against human SLC27A5 recombinant protein. (Expected MW is 32.9 kDa)
(1 Publication)
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P

Publications for Laminin alpha 5 Antibody (NBP2-42391)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC-P, WB.


Filter By Application
IHC-P
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Laminin alpha 5 Antibody (NBP2-42391) (0)

There are no reviews for Laminin alpha 5 Antibody (NBP2-42391). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Laminin alpha 5 Antibody (NBP2-42391) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Laminin alpha 5 Knockout HeLa Cell Lysate

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Laminin alpha 5 Products

Bioinformatics Tool for Laminin alpha 5 Antibody (NBP2-42391)

Discover related pathways, diseases and genes to Laminin alpha 5 Antibody (NBP2-42391). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Laminin alpha 5 Antibody (NBP2-42391)

Discover more about diseases related to Laminin alpha 5 Antibody (NBP2-42391).
 

Pathways for Laminin alpha 5 Antibody (NBP2-42391)

View related products by pathway.

PTMs for Laminin alpha 5 Antibody (NBP2-42391)

Learn more about PTMs related to Laminin alpha 5 Antibody (NBP2-42391).

Blogs on Laminin alpha 5

There are no specific blogs for Laminin alpha 5, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Laminin alpha 5 Antibody (CL3118) and receive a gift card or discount.


Bioinformatics

Gene Symbol LAMA5
Uniprot
COVID-19 update