Lamin B Receptor Antibody

Images

 
Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [NBP2-14185] - Staining of human lymph node shows distinct nuclear membranous positivity in lymphoid cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Lamin B Receptor Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MPSRKFADGEVVRGRWPGSSLYYEVEILSHDSTSQLYTVKYKDGTELELK ENDIKPLTSFRQRKGGSTSSS
Marker
Nuclear Inner Membrane Marke
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LBR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Lamin B Receptor Protein (NBP2-14185PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Lamin B Receptor Antibody

  • DHCR14B
  • FLJ43126
  • Integral nuclear envelope inner membrane protein
  • lamin B receptor
  • lamin-B receptor
  • LMN2R
  • MGC9041
  • PHA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP1-89366
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP2-56060
Species: Hu
Applications: ICC/IF
H00030813-R02
Species: Hu
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-26666
Species: Mu
Applications: B/N, Flow, IP, In vitro

Publications for Lamin B Receptor Antibody (NBP2-14185) (0)

There are no publications for Lamin B Receptor Antibody (NBP2-14185).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lamin B Receptor Antibody (NBP2-14185) (0)

There are no reviews for Lamin B Receptor Antibody (NBP2-14185). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Lamin B Receptor Antibody (NBP2-14185) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lamin B Receptor Products

Bioinformatics Tool for Lamin B Receptor Antibody (NBP2-14185)

Discover related pathways, diseases and genes to Lamin B Receptor Antibody (NBP2-14185). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lamin B Receptor Antibody (NBP2-14185)

Discover more about diseases related to Lamin B Receptor Antibody (NBP2-14185).
 

Pathways for Lamin B Receptor Antibody (NBP2-14185)

View related products by pathway.

PTMs for Lamin B Receptor Antibody (NBP2-14185)

Learn more about PTMs related to Lamin B Receptor Antibody (NBP2-14185).

Blogs on Lamin B Receptor

There are no specific blogs for Lamin B Receptor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lamin B Receptor Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LBR