Lamin B Receptor Antibody - BSA Free

Western Blot: Lamin B Receptor Antibody [NBP1-59845] - RPMI 8226 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Lamin B Receptor Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to LBR (lamin B receptor) The peptide sequence was selected from the middle region of LBR)(50ug). Peptide sequence GANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDL. The peptide sequence for this immunogen was taken from within the described region.
• Marker: Nuclear Inner Membrane Marke
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LBR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunoprecipitation
  • Western Blot 1.0 ug/ml
• Theoretical MW: 71 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Lamin B Receptor Antibody - BSA Free

• DHCR14B
• FLJ43126
• Integral nuclear envelope inner membrane protein
• lamin B receptor
• lamin-B receptor
• LMN2R
• MGC9041
• PHA

Background

The protein encoded by this gene belongs to the ERG4/ERG24 family. It localized in the nuclear envelope inner membrane and anchors the lamina and the heterochromatin to the membrane. It may mediate interaction between chromatin and lamin B. Mutations of this gene has been associated with autosomal recessive HEM/Greenberg skeletal dysplasia. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LBR
• Uniprot:
  • Q14739(Human)