LAMC3 Antibody - BSA Free Summary
                         
                                
                                
                                
            | Description | 
            Novus Biologicals Rabbit LAMC3 Antibody - BSA Free (NBP2-33895) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.  | 
        
            | Immunogen | 
            This antibody was developed against a recombinant protein corresponding to amino acids: CLPCNCSGRSEECTFDRELFRSTGHGGRCHHCRDHTAGPHCERCQENFYHWDPRMPCQPCDCQSAGSLHLQCDDTGTCACKPTVTGWKCDRCLPGFHSLSEGGCRPCTCNPAGSLDTCDPRSGRCPCKENVEG  | 
        
            | Isotype | 
            IgG  | 
        
            | Clonality | 
            Polyclonal  | 
        
            | Host | 
            Rabbit  | 
        
            | Gene | 
            LAMC3  | 
        
            | Purity | 
            Immunogen affinity purified  | 
        
            | Innovator's Reward | 
            Test in a species/application not listed above to receive a full credit towards a future purchase.  | 
        
                                
                          Applications/Dilutions
                                
                                    
                                    
                                        
                              
                                  | Dilutions | 
                                  
                                      - Immunohistochemistry 1:200 - 1:500
 - Immunohistochemistry-Paraffin 1:200 - 1:500
 
                                       
                                   | 
                              
            | Application Notes | 
            For IHC-Paraffin, HIER pH 6 retrieval is recommended.  | 
        
                                        
                                            | Control Peptide | 
                                            
                                                
                                             | 
                                        
                                    
                                 Reactivity Notes
                        
                                
                                        
                                        Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (83%)
                                          Packaging, Storage & Formulations
            | Storage | 
            Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.  | 
        
            | Buffer | 
            PBS (pH 7.2) and 40% Glycerol  | 
        
            | Preservative | 
            0.02% Sodium Azide  | 
        
            | Purity | 
            Immunogen affinity purified  | 
        
Alternate Names for LAMC3 Antibody - BSA Free
                     Limitations
 
                    
                    This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are 
guaranteed for 1 year from date of receipt.
 
                     Customers Who Viewed This Item Also Viewed...
                
                
                            
                                  
                                       
                                                Species: Hu
Applications: BA
                                     
                                 
                             
                            
                                  
                                       
                                                
                                                Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
                                     
                                 
                              
                            
                                  
                                       
                                                Species: Hu
Applications: IHC
                                     
                                 
                             
                            
                                  
                                       
                                                Species: Hu
Applications: ELISA
                                     
                                 
                              
                            
                                  
                                       
                                                
                                                Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
                                     
                                 
                             
                            
                                  
                                       
                                                
                                                Species: Hu
Applications: ICC, Simple Western, WB
                                     
                                 
                              
                            
                                  
                                       
                                                Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, IHC,  IHC-P, WB
                                     
                                 
                             
                            
                                  
                                       
                                                Species: Hu
Applications: BA
                                     
                                 
                              
                            
                                  
                                       Species: Hu
Applications: IHC, WB
                                     
                                 
                             
                            
                                  
                                       Species: Hu
Applications: IHC,  IHC-P
                                     
                                 
                              
                            
                                  
                                       
                                                
                                                Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
                                     
                                 
                             
                            
                                  
                                       
                                                Species: Mu
Applications: BA
                                     
                                 
                              
                            
                                  
                                       
                                                Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
                                     
                                 
                             
                            
                                  
                                       Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
                                     
                                 
                              
                            
                                  
                                       Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
                                     
                                 
                             
                            
                                  
                                       
                                                
                                                Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
                                     
                                 
                              
                            
                                  
                                       
                                                Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
                                     
                                 
                             
                            
                                  
                                       Species: Hu
Applications: ICC, IHC, WB
                                     
                                 
                              
                      
                  
            
                        
                        Publications for LAMC3 Antibody (NBP2-33895) (0)
             
            
                        There are no publications for LAMC3 Antibody (NBP2-33895).
                        By submitting your publication information earn gift cards and discounts for future purchases.
             
            
                        
                        Reviews for LAMC3 Antibody (NBP2-33895) (0)	
                        
                        There are no reviews for LAMC3 Antibody (NBP2-33895).
                        By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount. 
                            
                                - Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
 
                                - Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
 
                            
                                   
                  Product General Protocols
                        
                        Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
                        
FAQs for LAMC3 Antibody (NBP2-33895) (0)
                        
                             
                  
                Secondary Antibodies
                    
                      |   | 
                Isotype Controls
                    
                     | 
Additional LAMC3 Products
                            
                            Blogs on LAMC3