Lactoperoxidase Antibody

Images

 
Immunohistochemistry-Paraffin: Lactoperoxidase Antibody [NBP1-87010] - Staining of human salivary gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Lactoperoxidase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IVGYLNEEGVLDQNRSLLFMQWGQIVDHDLDFAPDTELGSSEYSKAQCDEYCIQGDNCFPIMFPPNDPKAGTQGKCMPFFRAGFVCPTPPYKSLAR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LPO
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Lactoperoxidase Protein (NBP1-87010PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Lactoperoxidase Antibody

  • EC 1.11.1
  • lactoperoxidase
  • MGC129990
  • MGC129991
  • Salivary peroxidase
  • SAPX
  • SPOEC 1.11.1.7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
NBP1-05027
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA, S-ELISA
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-935
Species: Bv
Applications: WB, ELISA, IP
NBP1-87010
Species: Hu
Applications: IHC, IHC-P

Publications for Lactoperoxidase Antibody (NBP1-87010) (0)

There are no publications for Lactoperoxidase Antibody (NBP1-87010).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lactoperoxidase Antibody (NBP1-87010) (0)

There are no reviews for Lactoperoxidase Antibody (NBP1-87010). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Lactoperoxidase Antibody (NBP1-87010) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lactoperoxidase Products

Bioinformatics Tool for Lactoperoxidase Antibody (NBP1-87010)

Discover related pathways, diseases and genes to Lactoperoxidase Antibody (NBP1-87010). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lactoperoxidase Antibody (NBP1-87010)

Discover more about diseases related to Lactoperoxidase Antibody (NBP1-87010).
 

Pathways for Lactoperoxidase Antibody (NBP1-87010)

View related products by pathway.

PTMs for Lactoperoxidase Antibody (NBP1-87010)

Learn more about PTMs related to Lactoperoxidase Antibody (NBP1-87010).
 

Research Areas for Lactoperoxidase Antibody (NBP1-87010)

Find related products by research area.

Blogs on Lactoperoxidase

There are no specific blogs for Lactoperoxidase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lactoperoxidase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LPO