Lactoperoxidase Antibody - BSA Free

Immunohistochemistry-Paraffin: Lactoperoxidase Antibody [NBP1-87010] - Staining of human colon shows low expression as expected.

Immunohistochemistry-Paraffin: Lactoperoxidase Antibody [NBP1-87010] - Staining of human salivary gland shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Lactoperoxidase Antibody [NBP1-87010] - Staining in human salivary gland and colon tissues using anti-LPO antibody. Corresponding LPO RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Lactoperoxidase Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Lactoperoxidase Antibody - BSA Free (NBP1-87010) is a polyclonal antibody validated for use in IHC. Anti-Lactoperoxidase Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IVGYLNEEGVLDQNRSLLFMQWGQIVDHDLDFAPDTELGSSEYSKAQCDEYCIQGDNCFPIMFPPNDPKAGTQGKCMPFFRAGFVCPTPPYKSLAR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LPO
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Lactoperoxidase Protein (NBP1-87010PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%) Use in Mouse reported in scientific literature (PMID:29858825).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Lactoperoxidase Antibody - BSA Free

• EC 1.11.1
• lactoperoxidase
• MGC129990
• MGC129991
• Salivary peroxidase
• SAPX
• SPOEC 1.11.1.7

Background

Lactoperoxidase is an antibacterial agent in cow milk. The heme protein lactoperoxidase (LPO), also referred to as salivary peroxidase (SPO), is an oxidoreductase secreted into milk. LPO belongs to the XPO subfamily of the peroxidase family. It is expressed in mammary and salivary glands, and in the presence of H2O2, LPO acts as a catalyst for the oxidation of many phenols and aromatic amines. It is crucial for protecting the lactating mammary gland and intestinal tract of newborn infants against microorganisms. LPO binds one calcium ion per heterodimer and one heme B (iron-protoporphyrin IX) group covalently per heterodimer. The LPO gene, which spans 28 kb, is similar in gene organization and sequence to the peroxidase genes MPO and EPX, suggesting the possibility that these genes evolved from a common ancestral gene. The LPO and MPO genes are arranged in a tail-to-tail manner on chromosome 17q23.1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Lactoperoxidase Antibody (NBP1-87010)(1)

Publication using NBP1-87010

• Sarr D, Toth E et al. Antimicrobial actions of dual oxidases and lactoperoxidase. J Microbiol 2018-01-06 [PMID: 29858825] (IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: LPO