L-Selectin/CD62L Recombinant Protein Antigen

Images

 
There are currently no images for L-Selectin/CD62L Recombinant Protein Antigen (NBP2-76545PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

L-Selectin/CD62L Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human L-Selectin/CD62L

Source: E.coli

Amino Acid Sequence: MGCRRTREGPSKAMIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTD

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SELL
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-76545. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for L-Selectin/CD62L Recombinant Protein Antigen

  • CD62L antigen
  • CD62L
  • gp90-MEL
  • hLHRc
  • LAM1
  • LAM-1
  • LAM1LECAM1
  • LECAM1
  • LEU8
  • Leu-8
  • Leukocyte adhesion molecule 1
  • Leukocyte surface antigen Leu-8
  • Leukocyte-endothelial cell adhesion molecule 1
  • LNHR
  • LNHRTQ1
  • LSEL
  • L-Selectin
  • LYAM1
  • Lyam-1
  • LYAM1CD62 antigen-like family member L
  • Lymph node homing receptor
  • lymphocyte adhesion molecule 1
  • pln homing receptor
  • PLNHR
  • selectin L
  • SELL
  • TQ1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1730
Species: Hu
Applications: Flow, AdBlk, CyTOF-ready, ICC
NB110-89474
Species: Hu, Mu, Rt, Bv, Ce, ChHa, Pm, RM
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Dual ISH-IHC, Single-Cell Western
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
BBA16
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
AF1008
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB100-77417
Species: Hu, Mu, Rt
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
6507-IL/CF
Species: Hu

Publications for L-Selectin/CD62L Recombinant Protein Antigen (NBP2-76545PEP) (0)

There are no publications for L-Selectin/CD62L Recombinant Protein Antigen (NBP2-76545PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for L-Selectin/CD62L Recombinant Protein Antigen (NBP2-76545PEP) (0)

There are no reviews for L-Selectin/CD62L Recombinant Protein Antigen (NBP2-76545PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for L-Selectin/CD62L Recombinant Protein Antigen (NBP2-76545PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional L-Selectin/CD62L Products

Bioinformatics Tool for L-Selectin/CD62L Recombinant Protein Antigen (NBP2-76545PEP)

Discover related pathways, diseases and genes to L-Selectin/CD62L Recombinant Protein Antigen (NBP2-76545PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for L-Selectin/CD62L Recombinant Protein Antigen (NBP2-76545PEP)

Discover more about diseases related to L-Selectin/CD62L Recombinant Protein Antigen (NBP2-76545PEP).
 

Pathways for L-Selectin/CD62L Recombinant Protein Antigen (NBP2-76545PEP)

View related products by pathway.

PTMs for L-Selectin/CD62L Recombinant Protein Antigen (NBP2-76545PEP)

Learn more about PTMs related to L-Selectin/CD62L Recombinant Protein Antigen (NBP2-76545PEP).
 

Research Areas for L-Selectin/CD62L Recombinant Protein Antigen (NBP2-76545PEP)

Find related products by research area.

Blogs on L-Selectin/CD62L.

L-selectin (CD62L antigen, Leukocyte surface antigen Leu-8)
L-selectin is a member of the selectin family of glycoprotein adhesion and homing receptors that recognize sialyated carbohydrate groups and regulate lymphocyte-endothelial cell interactions. It is a type I transmembrane cell adhesion molecule (CAM) a...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our L-Selectin/CD62L Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SELL