L-Selectin/CD62L Recombinant Protein Antigen

Images

 
There are currently no images for L-Selectin/CD62L Recombinant Protein Antigen (NBP2-76545PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

L-Selectin/CD62L Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human L-Selectin/CD62L.

Source: E. coli

Amino Acid Sequence: MGCRRTREGPSKAMIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SELL
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-76545.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for L-Selectin/CD62L Recombinant Protein Antigen

  • CD62L antigen
  • CD62L
  • gp90-MEL
  • hLHRc
  • LAM1
  • LAM-1
  • LAM1LECAM1
  • LECAM1
  • LEU8
  • Leu-8
  • Leukocyte adhesion molecule 1
  • Leukocyte surface antigen Leu-8
  • Leukocyte-endothelial cell adhesion molecule 1
  • LNHR
  • LNHRTQ1
  • LSEL
  • L-Selectin
  • LYAM1
  • Lyam-1
  • LYAM1CD62 antigen-like family member L
  • Lymph node homing receptor
  • lymphocyte adhesion molecule 1
  • pln homing receptor
  • PLNHR
  • selectin L
  • SELL
  • TQ1

Background

L-selectin, also known as CD62L, is a type I transmembrane glycoprotein that is primarily expressed on leukocytes and has a role in cell adhesion and migration (1,2). L-selectin is closely related to the other family members E- and P-selectin (1,2). Human L-selectin protein is encoded by SELL and is 372 amino acids (aa) in length with a predicted molecular weight (MW) of ~30 kDa (1,2). However, due to glycosylation the observed MW ranges between 65-100 kDa and glycosylation is cell-type dependent (1,2). The L-selectin protein contains an N-terminal C-type lectin domain (CTLD), an epidermal growth factor (EGF)-like domain, two sequence consensus repeat (CSR) domains, a cleavage site, a transmembrane (TM) domain, and a short cytoplasmic tail (1,2).

L-selectin expressed on leukocytes binds to ligands expressed by endothelial cells where it plays a role in lymphocyte homing to secondary lymphoid organs (2-5). L-selectin specifically recognizes and binds to sulfated sialyl-Lewis epitopes of O-linked glycans (2-4). Ligands for L-selectin include glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), CD34, mucosal vascular addressin cell adhesion molecule-1 (MAdCAM-1), and P-selectin glycoprotein ligand-1 (PSGL-1) (2,4). Elevated levels of selectin ligands on tumor cells are associated with cancer progression and metastasis (3). High levels of L-selectin and soluble L-selectin (sL-selectin) has been implicated in a number of pathologies from viral infection and allergies, to sepsis and multiple sclerosis (2,4,5). For example, L-selectin has been shown to play a role in human immunodeficiency virus (HIV) infection. HIV envelope glycans, such as gp120, binds to L-selectin/CD62L on CD4+ T cells, facilitating viral adhesion (2,5). A disintegrin and metalloproteinase (ADAM)17 is the primary enzyme responsible for L-selectin shedding in leukocytes, which is triggered in response to inflammatory signals (1,2,5). AMAD17 inhibitors block L-selectin shedding and reduce viral release (2,5). Given their role in cancer and other diseases, selectins and their ligands are potential targets for therapeutic intervention (3,5). For instance, murine models have shown that anti-L-selectin antibodies can delay onset of graft versus host disease (5).

References

1. Ivetic A. (2018). A head-to-tail view of L-selectin and its impact on neutrophil behaviour. Cell and Tissue Research, 371(3), 437-453. https://doi.org/10.1007/s00441-017-2774-x

2. Ivetic, A., Hoskins Green, H. L., & Hart, S. J. (2019). L-selectin: a major regulator of leukocyte adhesion, migration and signaling. Frontiers in Immunology, 10, 1068. https://doi.org/10.3389/fimmu.2019.01068

3. Borsig L. (2018). Selectins in cancer immunity. Glycobiology, 28(9), 648-655. https://doi.org/10.1093/glycob/cwx105

4. Kneuer, C., Ehrhardt, C., Radomski, M. W., & Bakowsky, U. (2006). Selectins-potential pharmacological targets?. Drug Discovery Today, 11(21-22), 1034-1040. https://doi.org/10.1016/j.drudis.2006.09.004

5. Segura, J., He, B., Ireland, J., Zou, Z., Shen, T., Roth, G., & Sun, P. D. (2021). The role of L-Selectin in HIV infection. Frontiers in Microbiology, 12, 725741. https://doi.org/10.3389/fmicb.2021.725741

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
7268-CT
Species: Hu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
137-PS
Species: Hu
Applications: BA
AF796
Species: Mu
Applications: AdBlk, IHC, WB
BBA16
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
MAB3595
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
AF629
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
202-IL
Species: Hu
Applications: BA
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
DR2A00
Species: Hu
Applications: ELISA
H00003669-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
6507-IL/CF
Species: Hu
Applications: BA

Publications for L-Selectin/CD62L Recombinant Protein Antigen (NBP2-76545PEP) (0)

There are no publications for L-Selectin/CD62L Recombinant Protein Antigen (NBP2-76545PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for L-Selectin/CD62L Recombinant Protein Antigen (NBP2-76545PEP) (0)

There are no reviews for L-Selectin/CD62L Recombinant Protein Antigen (NBP2-76545PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for L-Selectin/CD62L Recombinant Protein Antigen (NBP2-76545PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional L-Selectin/CD62L Products

Research Areas for L-Selectin/CD62L Recombinant Protein Antigen (NBP2-76545PEP)

Find related products by research area.

Blogs on L-Selectin/CD62L.

L-selectin (CD62L antigen, Leukocyte surface antigen Leu-8)
L-selectin is a member of the selectin family of glycoprotein adhesion and homing receptors that recognize sialyated carbohydrate groups and regulate lymphocyte-endothelial cell interactions. It is a type I transmembrane cell adhesion molecule (CAM) a...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our L-Selectin/CD62L Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SELL