L-Selectin/CD62L Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: L-Selectin/CD62L Antibody [NBP2-76545] - Staining of human cell line REH shows localization to cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

L-Selectin/CD62L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MGCRRTREGPSKAMIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SELL
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for L-Selectin/CD62L Antibody

  • CD62L antigen
  • CD62L
  • gp90-MEL
  • hLHRc
  • LAM1
  • LAM-1
  • LAM1LECAM1
  • LECAM1
  • LEU8
  • Leu-8
  • Leukocyte adhesion molecule 1
  • Leukocyte surface antigen Leu-8
  • Leukocyte-endothelial cell adhesion molecule 1
  • LNHR
  • LNHRTQ1
  • LSEL
  • L-Selectin
  • LYAM1
  • Lyam-1
  • LYAM1CD62 antigen-like family member L
  • Lymph node homing receptor
  • lymphocyte adhesion molecule 1
  • pln homing receptor
  • PLNHR
  • selectin L
  • SELL
  • TQ1

Background

L-selectin, also known as CD62L, is a type I transmembrane glycoprotein that is primarily expressed on leukocytes and has a role in cell adhesion and migration (1,2). L-selectin is closely related to the other family members E- and P-selectin (1,2). Human L-selectin protein is encoded by SELL and is 372 amino acids (aa) in length with a predicted molecular weight (MW) of ~30 kDa (1,2). However, due to glycosylation the observed MW ranges between 65-100 kDa and glycosylation is cell-type dependent (1,2). The L-selectin protein contains an N-terminal C-type lectin domain (CTLD), an epidermal growth factor (EGF)-like domain, two sequence consensus repeat (CSR) domains, a cleavage site, a transmembrane (TM) domain, and a short cytoplasmic tail (1,2).

L-selectin expressed on leukocytes binds to ligands expressed by endothelial cells where it plays a role in lymphocyte homing to secondary lymphoid organs (2-5). L-selectin specifically recognizes and binds to sulfated sialyl-Lewis epitopes of O-linked glycans (2-4). Ligands for L-selectin include glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), CD34, mucosal vascular addressin cell adhesion molecule-1 (MAdCAM-1), and P-selectin glycoprotein ligand-1 (PSGL-1) (2,4). Elevated levels of selectin ligands on tumor cells are associated with cancer progression and metastasis (3). High levels of L-selectin and soluble L-selectin (sL-selectin) has been implicated in a number of pathologies from viral infection and allergies, to sepsis and multiple sclerosis (2,4,5). For example, L-selectin has been shown to play a role in human immunodeficiency virus (HIV) infection. HIV envelope glycans, such as gp120, binds to L-selectin/CD62L on CD4+ T cells, facilitating viral adhesion (2,5). A disintegrin and metalloproteinase (ADAM)17 is the primary enzyme responsible for L-selectin shedding in leukocytes, which is triggered in response to inflammatory signals (1,2,5). AMAD17 inhibitors block L-selectin shedding and reduce viral release (2,5). Given their role in cancer and other diseases, selectins and their ligands are potential targets for therapeutic intervention (3,5). For instance, murine models have shown that anti-L-selectin antibodies can delay onset of graft versus host disease (5).

References

1. Ivetic A. (2018). A head-to-tail view of L-selectin and its impact on neutrophil behaviour. Cell and Tissue Research, 371(3), 437-453. https://doi.org/10.1007/s00441-017-2774-x

2. Ivetic, A., Hoskins Green, H. L., & Hart, S. J. (2019). L-selectin: a major regulator of leukocyte adhesion, migration and signaling. Frontiers in Immunology, 10, 1068. https://doi.org/10.3389/fimmu.2019.01068

3. Borsig L. (2018). Selectins in cancer immunity. Glycobiology, 28(9), 648-655. https://doi.org/10.1093/glycob/cwx105

4. Kneuer, C., Ehrhardt, C., Radomski, M. W., & Bakowsky, U. (2006). Selectins-potential pharmacological targets?. Drug Discovery Today, 11(21-22), 1034-1040. https://doi.org/10.1016/j.drudis.2006.09.004

5. Segura, J., He, B., Ireland, J., Zou, Z., Shen, T., Roth, G., & Sun, P. D. (2021). The role of L-Selectin in HIV infection. Frontiers in Microbiology, 12, 725741. https://doi.org/10.3389/fmicb.2021.725741

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
7268-CT
Species: Hu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
137-PS
Species: Hu
Applications: BA
210-TA
Species: Hu
Applications: BA
796-IC
Species: Mu
Applications: BA
BBA16
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
NB500-328
Species: Hu
Applications: CyTOF-ready, Flow, IP
AF1008
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
202-IL
Species: Hu
Applications: BA
NB100-77417
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, WB
285-IF
Species: Hu
Applications: BA
DR2A00
Species: Hu
Applications: ELISA
H00003669-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
6507-IL/CF
Species: Hu
Applications: BA

Publications for L-Selectin/CD62L Antibody (NBP2-76545) (0)

There are no publications for L-Selectin/CD62L Antibody (NBP2-76545).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for L-Selectin/CD62L Antibody (NBP2-76545) (0)

There are no reviews for L-Selectin/CD62L Antibody (NBP2-76545). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for L-Selectin/CD62L Antibody (NBP2-76545) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional L-Selectin/CD62L Products

Bioinformatics Tool for L-Selectin/CD62L Antibody (NBP2-76545)

Discover related pathways, diseases and genes to L-Selectin/CD62L Antibody (NBP2-76545). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for L-Selectin/CD62L Antibody (NBP2-76545)

Discover more about diseases related to L-Selectin/CD62L Antibody (NBP2-76545).
 

Pathways for L-Selectin/CD62L Antibody (NBP2-76545)

View related products by pathway.

PTMs for L-Selectin/CD62L Antibody (NBP2-76545)

Learn more about PTMs related to L-Selectin/CD62L Antibody (NBP2-76545).
 

Research Areas for L-Selectin/CD62L Antibody (NBP2-76545)

Find related products by research area.

Blogs on L-Selectin/CD62L.

L-selectin (CD62L antigen, Leukocyte surface antigen Leu-8)
L-selectin is a member of the selectin family of glycoprotein adhesion and homing receptors that recognize sialyated carbohydrate groups and regulate lymphocyte-endothelial cell interactions. It is a type I transmembrane cell adhesion molecule (CAM) a...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our L-Selectin/CD62L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SELL