| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MGCRRTREGPSKAMIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SELL |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for L-Selectin/CD62L Antibody (NBP2-76545)Find related products by research area.
|
|
L-selectin (CD62L antigen, Leukocyte surface antigen Leu-8) L-selectin is a member of the selectin family of glycoprotein adhesion and homing receptors that recognize sialyated carbohydrate groups and regulate lymphocyte-endothelial cell interactions. It is a type I transmembrane cell adhesion molecule (CAM) a... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SELL |