KMT3B/NSD1 Antibody - BSA Free

Immunohistochemistry: KMT3B/NSD1 Antibody [NBP2-68968] - Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts and Leydig cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KMT3B/NSD1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSAEPGTETSQVNLSDLKASTLVHKPQSDFT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NSD1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6
• Control Peptide:

  KMT3B/NSD1 Recombinant Protein Antigen (NBP2-68968PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for KMT3B/NSD1 Antibody - BSA Free

• Androgen receptor coactivator 267 kDa protein
• Androgen receptor-associated protein of 267 kDa
• ARA267STO
• DKFZp666C163
• EC 2.1.1.43
• FLJ10684
• FLJ22263
• FLJ44628
• H3 lysine-36 and H4 lysine-20 specific
• KMT3BSotos syndrome
• Lysine N-methyltransferase 3B
• NR-binding SET domain-containing protein
• nuclear receptor binding SET domain protein 1

Background

KMT3B / NSD1 encodes a protein containing a SET domain, 2 LXXLL motifs, 3 nuclear translocation signals (NLSs), 4 plant homeodomain (PHD) finger regions, and a proline-rich region. The encoded protein enhances androgen receptor (AR) transactivation, and this enhancement can be increased further in the presence of other androgen receptor associated coregulators. This protein may act as a nucleus-localized, basic transcriptional factor and also as a bifunctional transcriptional regulator. Mutations of this gene have been associated with Sotos syndrome and Weaver syndrome. One version of childhood acute myeloid leukemia is the result of a cryptic translocation with the breakpoints occurring within nuclear receptor-binding Su-var, enhancer of zeste, and trithorac domain protein 1 on chromosome 5 and nucleoporin, 98-kd on chromosome 11. Two transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NSD1