ZNF496 Antibody (2B3)

Images

 
Western Blot: ZNF496 Antibody (2B3) [H00084838-M08] - Analysis of ZNF496 expression in NIH/3T3 (Cat # L018V1).
Immunocytochemistry/ Immunofluorescence: ZNF496 Antibody (2B3) [H00084838-M08] - Analysis of monoclonal antibody to ZNF496 on NIH/3T3 cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: ZNF496 Antibody (2B3) [H00084838-M08] - Analysis of monoclonal antibody to ZNF496 on formalin-fixed paraffin-embedded human cholangiocarcinoma. Antibody concentration 1.5 ug/ml

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
2B3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZNF496 Antibody (2B3) Summary

Immunogen
ZNF496 (NP_116141, 485 a.a. ~ 585 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HLQPDRLQPVEKREQAASEDADKGPKEPLENGKAKLSFQCCECGKAFQRHDHLARHRSHFHLKDKARPFQCRYCVKSFTQNYDLLRHERLHMKRRSKQALN
Specificity
ZNF496 (2B3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF496
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for ELISA, immunofluoresence and immunohistochemistry (paraffin).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF496 Antibody (2B3)

  • zinc finger protein 232
  • ZSCAN11Zinc finger and SCAN domain-containing protein 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1744
Species: Hu
Applications: IHC, IHC-P
NB100-2214
Species: Hu, Mu, Rb
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
MAB5285
Species: Hu
Applications: Simple Western, WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NB100-381
Species: Hu
Applications: ChIP, IP, WB
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
NBP3-09392
Species: Hu, Mu
Applications: WB
NBP2-07996
Species: Hu
Applications: WB
H00008363-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00008294-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00008362-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB21-2024
Species: Hu, Ma, Mu, Po, Rt
Applications: ChIP, DB, ICC/IF, WB
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
NBL1-11567
Species: Hu
Applications: WB
NB100-295
Species: Hu, Mu(-), Rt
Applications: EM, ICC/IF, IHC, IHC-P, WB
AF6394
Species: Hu
Applications: IP, WB

Publications for ZNF496 Antibody (H00084838-M08) (0)

There are no publications for ZNF496 Antibody (H00084838-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF496 Antibody (H00084838-M08) (0)

There are no reviews for ZNF496 Antibody (H00084838-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF496 Antibody (H00084838-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF496 Products

Bioinformatics Tool for ZNF496 Antibody (H00084838-M08)

Discover related pathways, diseases and genes to ZNF496 Antibody (H00084838-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF496 Antibody (H00084838-M08)

Discover more about diseases related to ZNF496 Antibody (H00084838-M08).

Blogs on ZNF496

There are no specific blogs for ZNF496, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF496 Antibody (2B3) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF496
Entrez
Uniprot