KMT3B/NSD1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KMT3B/NSD1 Antibody [NBP2-55512] - Staining of human cell line HEK 293 shows localization to nucleus & cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KMT3B/NSD1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: INEECSLKCCSSDTKGSPLASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHIPIEPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLVSY
Specificity
Specificity of human KMT3B/NSD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NSD1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KMT3B/NSD1 Recombinant Protein Antigen (NBP2-55512PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for KMT3B/NSD1 Antibody

  • Androgen receptor coactivator 267 kDa protein
  • Androgen receptor-associated protein of 267 kDa
  • ARA267STO
  • DKFZp666C163
  • EC 2.1.1.43
  • FLJ10684
  • FLJ22263
  • FLJ44628
  • H3 lysine-36 and H4 lysine-20 specific
  • KMT3BSotos syndrome
  • Lysine N-methyltransferase 3B
  • NR-binding SET domain-containing protein
  • nuclear receptor binding SET domain protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27406
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
NBP1-82633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-04991
Species: Hu
Applications: ICC/IF (-), WB
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88619
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00084838-M08
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-93325
Species: Hu
Applications: WB, ICC/IF, IP
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-90117
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KMT3B/NSD1 Antibody (NBP2-55512) (0)

There are no publications for KMT3B/NSD1 Antibody (NBP2-55512).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KMT3B/NSD1 Antibody (NBP2-55512) (0)

There are no reviews for KMT3B/NSD1 Antibody (NBP2-55512). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KMT3B/NSD1 Antibody (NBP2-55512) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KMT3B/NSD1 Products

Bioinformatics Tool for KMT3B/NSD1 Antibody (NBP2-55512)

Discover related pathways, diseases and genes to KMT3B/NSD1 Antibody (NBP2-55512). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KMT3B/NSD1 Antibody (NBP2-55512)

Discover more about diseases related to KMT3B/NSD1 Antibody (NBP2-55512).
 

Pathways for KMT3B/NSD1 Antibody (NBP2-55512)

View related products by pathway.

PTMs for KMT3B/NSD1 Antibody (NBP2-55512)

Learn more about PTMs related to KMT3B/NSD1 Antibody (NBP2-55512).
 

Research Areas for KMT3B/NSD1 Antibody (NBP2-55512)

Find related products by research area.

Blogs on KMT3B/NSD1

There are no specific blogs for KMT3B/NSD1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KMT3B/NSD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NSD1