KLRG1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KLRG1 Antibody [NBP2-57506] - Staining of human cell line U-2 OS shows localization to vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KLRG1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSE
Specificity
Specificity of human KLRG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLRG1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KLRG1 Recombinant Protein Antigen (NBP2-57506PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for KLRG1 Antibody

  • 2F1
  • CLEC15A
  • CLEC15AMAFA-LIKE
  • C-type lectin domain family 15 member A
  • C-type lectin domain family 15, member A
  • ITIM-containing receptor MAFA-L
  • killer cell lectin-like receptor subfamily G member 1
  • killer cell lectin-like receptor subfamily G, member 1
  • KLRG1
  • MAFA
  • MAFAL
  • MAFA-L
  • MAFA-like receptor
  • MAFAMAFA-2F1
  • mast cell function-associated antigen (ITIM-containing)
  • Mast cell function-associated antigen
  • MGC13600

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
AF3444
Species: Hu
Applications: WB
NBP1-84079
Species: Hu
Applications: WB, IHC, IHC-P
H00004760-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-49672
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
DDX0700P-100
Species: Hu, Ca
Applications: Flow, IP, B/N
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF

Publications for KLRG1 Antibody (NBP2-57506) (0)

There are no publications for KLRG1 Antibody (NBP2-57506).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLRG1 Antibody (NBP2-57506) (0)

There are no reviews for KLRG1 Antibody (NBP2-57506). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KLRG1 Antibody (NBP2-57506) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KLRG1 Products

Bioinformatics Tool for KLRG1 Antibody (NBP2-57506)

Discover related pathways, diseases and genes to KLRG1 Antibody (NBP2-57506). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLRG1 Antibody (NBP2-57506)

Discover more about diseases related to KLRG1 Antibody (NBP2-57506).
 

Pathways for KLRG1 Antibody (NBP2-57506)

View related products by pathway.

PTMs for KLRG1 Antibody (NBP2-57506)

Learn more about PTMs related to KLRG1 Antibody (NBP2-57506).
 

Research Areas for KLRG1 Antibody (NBP2-57506)

Find related products by research area.

Blogs on KLRG1

There are no specific blogs for KLRG1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLRG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLRG1