KLRG1 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: KLRG1 Antibody [NBP2-57506] - Staining of human cell line U-2 OS shows localization to vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

KLRG1 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit KLRG1 Antibody - BSA Free (NBP2-57506) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLRG1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KLRG1 Recombinant Protein Antigen (NBP2-57506PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for KLRG1 Antibody - BSA Free

  • 2F1
  • CLEC15A
  • CLEC15AMAFA-LIKE
  • C-type lectin domain family 15 member A
  • C-type lectin domain family 15, member A
  • ITIM-containing receptor MAFA-L
  • killer cell lectin-like receptor subfamily G member 1
  • killer cell lectin-like receptor subfamily G, member 1
  • KLRG1
  • MAFA
  • MAFAL
  • MAFA-L
  • MAFA-like receptor
  • MAFAMAFA-2F1
  • mast cell function-associated antigen (ITIM-containing)
  • Mast cell function-associated antigen
  • MGC13600

Background

KLRG1 (killer cell lectin-like receptor G1), also known as CLEC15A and MAFA, belongs to the KLR family. KLRG1 is a lectin-like inhibitory receptor that is a single pass type II transmembrane protein (1). KLRG1 functions in innate immunity and has an inhibitory role on the function of natural killer (NK) cells and T cells that is induced by binding to their non-MHC ligands (1,2). The KLRG1 protein exists as both a monomer and homodimer and is expressed as an inhibitory receptor on NK cells as well as subsets of CD4+ and CD8+ T cells, gammadelta T cells, and alphabeta T cells (1,3,4). The human KLRG1 protein is 195 amino acids (aa) in length with a theoretical molecular weight (MW) of 21.8 kDa (2). Given KLRG1 protein glycosylation and disulfide bonds, the observed molecular weight often ranges from 30-38 kDa. The human KLRG1 protein consists of a cytoplasmic domain at 1-38 aa with one immunoreceptor tyrosine-based inhibitory motif (ITIM) at 5-10 aa, a transmembrane segment at 39-59 aa, and an extracellular domain (ECD) at 60-195 aa with one C-type lectin domain (CTLD) at 82-185 aa (2).

KLRG1's primary ligand is E-cadherin, which is expressed on non-neural epithelial tissues, but the KLRG1 receptor also recognizes both N- and R-cadherin expressed in nervous system tissues (1,3,5,6). E-cadherin binding of KLRG1 leads to ITIM triggering and, ultimately, either reduced T cell proliferation or decreased NK cell cytotoxicity (3,5,6). More precisely, upon differentiation of CD8+ T cells, cells switch from signaling through CD28 and instead signal through the inhibitory KLRG1 receptor molecule (3,4). Phosphorylation of KLRG1's ITIM causes recruitment of two phosphatases, SH2-containing inositol polyphosphate 5-phoshate (SHIP-1) and SH-2 containing protein-tyrosine phosphatase 2 (SHP-2) (3,5). The effectors SHIP-1 and SHP-2 degrade PIP3 to PIP2, preventing Akt phosphorylation and inhibiting proliferation (3,5,6). Conversely, when KLRG1 signaling is blocked in highly differentiated T cells, Akt signaling is restored and cell proliferation resumes (3). An increase in highly differentiated T cells is observed in many age-related infections such as meningitis, pneumonia, and influenza, which also correlates with elevated KLRG1 levels (3). This observation suggests that KLRG1 may be a potential immunotherapeutic target, especially for vaccinations which typically have decreased response in aged patients (3).

References

1. Li Y, Hofmann M, Wang Q, Teng L, Chlewicki LK, Pircher H, Mariuzza RA. Structure of natural killer cell receptor KLRG1 bound to E-cadherin reveals basis for MHC-independent missing self recognition. Immunity. 2009 Jul 17;31(1):35-46. http://doi.org/10.1016/j.immuni.2009.04.019

2. Uniprot(Q96E93)

3. Henson SM, Akbar AN. KLRG1--more than a marker for T cell senescence. Age (Dordr). 2009 Dec;31(4):285-91. http://doi.org/10.1007/s11357-009-9100-9.

4. Thimme R, Appay V, Koschella M, Panther E, Roth E, Hislop AD, Rickinson AB, Rowland-Jones SL, Blum HE, Pircher H. Increased expression of the NK cell receptor KLRG1 by virus-specific CD8 T cells during persistent antigen stimulation. J Virol. 2005 Sep;79(18):12112-6.http://doi.org/10.1128/JVI.79.18.12112-12116.2005.

5. Borys SM, Bag AK, Brossay L, Adeegbe DO. The Yin and Yang of Targeting KLRG1+ Tregs and Effector Cells. Front Immunol. 2022 Apr 29;13:894508. http://doi.org10.3389/fimmu.2022.894508.

6. Van den Bossche J, Malissen B, Mantovani A, De Baetselier P, Van Ginderachter JA. Regulation and function of the E-cadherin/catenin complex in cells of the monocyte-macrophage lineage and DCs. Blood. 2012 Feb 16;119(7):1623-33. http://doi.org/10.1182/blood-2011-10-384289.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF2419
Species: Hu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
AF3444
Species: Hu
Applications: IHC, WB
NBP1-84079
Species: Hu
Applications: IHC,  IHC-P, WB
AF2746
Species: Hu, Mu
Applications: ICC, WB
NBP2-24551
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-49672
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, Simple Western, WB
NBP2-22218
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
247-ILB
Species: Hu
Applications: BA
DDX0700P-100
Species: Ca, Hu
Applications: B/N, Flow, IP
202-IL
Species: Hu
Applications: BA
207-IL
Species: Hu
Applications: BA
BBA24
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB

Publications for KLRG1 Antibody (NBP2-57506) (0)

There are no publications for KLRG1 Antibody (NBP2-57506).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLRG1 Antibody (NBP2-57506) (0)

There are no reviews for KLRG1 Antibody (NBP2-57506). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KLRG1 Antibody (NBP2-57506) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KLRG1 Products

Research Areas for KLRG1 Antibody (NBP2-57506)

Find related products by research area.

Blogs on KLRG1

There are no specific blogs for KLRG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLRG1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol KLRG1