KLF9 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: KLF9 Antibody [NBP1-88507] - Staining of human cell line A-431 shows positivity in cytoplasm & nucleus but excluded from the nucleoli. Antibody staining is whown in green.

Analysis in control (vector only transfected HEK293T lysate) and KLF9 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KLF9 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:QCLVSISNRAAVPEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSAPSPLSLLHPGVAAKGKHASEKRHKCPYS
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLF9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KLF9 Antibody - BSA Free

• basic transcription element binding protein 1
• Basic transcription element-binding protein 1
• BTEB1GC-box-binding protein 1
• BTEBBTE-binding protein 1
• Krueppel-like factor 9
• Kruppel-like factor 9
• Transcription factor BTEB1

Background

KLF9 is a gene that codes for a transcription factor that activates mRNA synthesis on a selective basis from genes that only contain tandem repeats of GC boxes, otherwise the gene will be suppressed, and it has a length of 244 amino acids, and amass of approximately 27 kDa. Studies have been conducted on diseases and disorders relating to this gene, including Kabuki syndrome, otosclerosis, leiomyoma, colorectal cancer, carcinoma, glioblastoma, cholesterol, thyroiditis, and leukemia. KLF9 has also been shown to have interactions with PGR, SP1, SIN3A, HDAC7, and ELAV1 in pathways such as the diurnally regulated gene pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KLF9