KLF9 Antibody

Images

 
Western Blot: KLF9 Antibody [NBP1-88507] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: KLF9 Antibody [NBP1-88507] - Staining of human cell line A-431 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
Immunohistochemistry-Paraffin: KLF9 Antibody [NBP1-88507] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.

Product Details

Summary
Product Discontinued
View other related KLF9 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-88507
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

KLF9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QCLVSISNRAAVPEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSAPSPLSLLHPGVAAKGKHASEKRHKCPYS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLF9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KLF9 Antibody

  • basic transcription element binding protein 1
  • Basic transcription element-binding protein 1
  • BTEB1GC-box-binding protein 1
  • BTEBBTE-binding protein 1
  • Krueppel-like factor 9
  • Kruppel-like factor 9
  • Transcription factor BTEB1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5415
Species: Hu
Applications: WB, IHC, ICC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NB200-107
Species: Hu, Mu
Applications: WB, ELISA, Flow, GS, IHC, IHC-Fr, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF3758
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-07799
Species: Hu
NBP1-76995
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007071-M15
Species: Hu, Mu, Rt
Applications: WB, ELISA
MAB4077
Species: Hu
Applications: WB, IHC
NBL1-11664
Species: Hu
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88507
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KLF9 Antibody (NBP1-88507) (0)

There are no publications for KLF9 Antibody (NBP1-88507).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLF9 Antibody (NBP1-88507) (0)

There are no reviews for KLF9 Antibody (NBP1-88507). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KLF9 Antibody (NBP1-88507) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KLF9 Products

Bioinformatics Tool for KLF9 Antibody (NBP1-88507)

Discover related pathways, diseases and genes to KLF9 Antibody (NBP1-88507). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLF9 Antibody (NBP1-88507)

Discover more about diseases related to KLF9 Antibody (NBP1-88507).
 

Pathways for KLF9 Antibody (NBP1-88507)

View related products by pathway.

PTMs for KLF9 Antibody (NBP1-88507)

Learn more about PTMs related to KLF9 Antibody (NBP1-88507).

Blogs on KLF9

There are no specific blogs for KLF9, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLF9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLF9