KLF15 Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human KLF15 (NP_054798.1). MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPCSCSSPDSQALCSCYGGGLGTESQDSILDFLLSQATLGSGGGSGSSIGASSGPVAWGPWRRAAAPVKGEHFCLPEFPLGDPDDVPRPFQPTLEEIEEFLEENMEPGVKEVPEGNSKDLDACSQLSAGPHKSHLHPGSSGRERCSPPPGGASAGGAQGPGGGPTPDGPIPVLLQIQPVPVKQESGTGPASPGQAPENVKVAQLLVNIQGQTF |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KLF15 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50-1:200
|
| Theoretical MW |
43 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for KLF15 Antibody - BSA Free
Background
The kidney chloride channel proteins CLCNKA and CLCNKB are highly related, although they are located in different areas of the kidney. Using a yeast 1-hybrid screen of a kidney cDNA library with the GA element of the CLCNKA promoter as bait, Uchida et al. (2000) isolated cDNAs encoding MAZ and KLF15, which they termed KKLF. Sequence analysis predicted that the 415-amino acid KLF15 protein, which is 84% identical to the rat Klf15 protein, contains 3 zinc finger motifs at its C terminus, N-terminal serine-rich stretches, and a central proline-rich segment. EMSA analysis confirmed that KLF15 and MAZ interact with the GA element of the CLCNKA promoter and showed that KLF15 binds with higher affinity and is a functional competitor of MAZ. Northern blot analysis revealed highest expression of a 2.5-kb KLF15 transcript in liver, followed by heart, skeletal muscle, and kidney. No expression was found in bone marrow or lymphoid tissues. Western blot analysis showed expression of a 50-kD protein. Immunohistochemical analysis detected nuclear expression of KLF15 in liver sinusoid stellate cells, subcapsular fibroblasts, and portal fibroblasts. KLF15 was also expressed in cardiac and skeletal muscle interstitial cells and in kidney inner medulla, glomeruli, and cortical interstitium. Immunofluorescence microscopy, however, demonstrated no colocalization of KLF15 with CLCNKA.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, KD, WB
Species: Mu
Applications: ChIP, ICC, IHC, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: EM, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: ICC/IF
Publications for KLF15 Antibody (NBP3-04599) (0)
There are no publications for KLF15 Antibody (NBP3-04599).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KLF15 Antibody (NBP3-04599) (0)
There are no reviews for KLF15 Antibody (NBP3-04599).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KLF15 Antibody (NBP3-04599) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KLF15 Products
Research Areas for KLF15 Antibody (NBP3-04599)
Find related products by research area.
|
Blogs on KLF15