Kir3.4 Antibody


Western Blot: Kir3.4 Antibody [NBP1-88082] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed more
Immunohistochemistry-Paraffin: Kir3.4 Antibody [NBP1-88082] - Staining of human pancreas shows strong membranous and cytoplasmic positivity in exocrine glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Kir3.4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TPVLTLEKGFYEVDYNTFHDTYETNTPSCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGG
Specificity of human Kir3.4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kir3.4 Protein (NBP1-88082PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Kir3.4 Antibody

  • Cardiac inward rectifier
  • CIRKIR3.4
  • G protein-activated inward rectifier potassium channel 4
  • GIRK-4
  • GIRK4Kir3.4
  • Heart KATP channel
  • Inward rectifier K(+) channel Kir3.4
  • inward rectifier K+ channel KIR3.4
  • IRK-4
  • KATP-1
  • KATP1cardiac ATP-sensitive potassium channel
  • LQT13
  • Potassium channel, inwardly rectifying subfamily J member 5
  • potassium inwardly-rectifying channel, subfamily J, member 5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, PEP-ELISA
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: IP (-), WB
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Kir3.4 Antibody (NBP1-88082) (0)

There are no publications for Kir3.4 Antibody (NBP1-88082).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kir3.4 Antibody (NBP1-88082) (0)

There are no reviews for Kir3.4 Antibody (NBP1-88082). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kir3.4 Antibody (NBP1-88082) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Kir3.4 Products

Bioinformatics Tool for Kir3.4 Antibody (NBP1-88082)

Discover related pathways, diseases and genes to Kir3.4 Antibody (NBP1-88082). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kir3.4 Antibody (NBP1-88082)

Discover more about diseases related to Kir3.4 Antibody (NBP1-88082).

Pathways for Kir3.4 Antibody (NBP1-88082)

View related products by pathway.

Blogs on Kir3.4

There are no specific blogs for Kir3.4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Kir3.4 Antibody and receive a gift card or discount.


Gene Symbol KCNJ5