Kir3.4 Antibody - BSA Free

Immunohistochemistry-Paraffin: Kir3.4 Antibody [NBP1-88081] - Analysis in human adrenal gland and skeletal muscle tissues. Corresponding Kir3.4 RNA-seq data are presented for the same tissues.

Staining of human adrenal gland shows moderate to strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Kir3.4 Antibody [NBP1-88081] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Kir3.4 Antibody [NBP1-88081] - Staining of human pancreas shows moderate to strong membranous positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: Kir3.4 Antibody [NBP1-88081] - Staining of human skin shows no positivity in squamous epithelial cells as expected.

Analysis in control (vector only transfected HEK293T lysate) and kCNJ5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Kir3.4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Kir3.4 Antibody - BSA Free (NBP1-88081) is a polyclonal antibody validated for use in IHC and WB. Anti-Kir3.4 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKCNVHHGNVQETY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNJ5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID: 25776071). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Kir3.4 Protein (NBP1-88081PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%). Reactivity reported in scientific literature (PMID: 23913004)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Kir3.4 Antibody - BSA Free

• Cardiac inward rectifier
• CIRKIR3.4
• G protein-activated inward rectifier potassium channel 4
• GIRK-4
• GIRK4Kir3.4
• Heart KATP channel
• Inward rectifier K(+) channel Kir3.4
• inward rectifier K+ channel KIR3.4
• IRK-4
• KATP-1
• KATP1cardiac ATP-sensitive potassium channel
• LQT13
• Potassium channel, inwardly rectifying subfamily J member 5
• potassium inwardly-rectifying channel, subfamily J, member 5

Background

G-protein regulated inward-rectifier potassium channels (GIRK) are part of a superfamily of inward-rectifier K+ channels. To date four GIRK subunits, designated GIRK1-4 (also designated Kir3.1-4), have been identified in mammals, and GIRK5 has been found in Xenopus oocytes. GIRK channels exist in vivo both as homotetramers and heterotetramers. GIRK channels are modulated by G-proteins; they are also modulated by phosphatidylinositol 4,5-bisphosphate, intracellular sodium, ethanol and mechanical stretch. GIRK1, 2 and 3 are highly abundant in brain. In general, neuronal GIRK channels are involved in the regulation of the excitability of neurons and may contribute to the resting potential.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Kir3.4 Antibody (NBP1-88081)(2)

Publications using NBP1-88081

• Zhou J, Shaikh LH, Neogi SG et al. DACH1, a Zona Glomerulosa Selective Gene in the Human Adrenal, Activates Transforming Growth Factor--beta Signaling and Suppresses Aldosterone Secretion. Hypertension 2015-05-01 [PMID: 25776071] (IF/IHC, Human)
• Azizan EA, Poulsen H, Tuluc P et al. Somatic mutations in ATP1A1 and CACNA1D underlie a common subtype of adrenal hypertension. Nat Genet 2013-09-01 [PMID: 23913004]

Bioinformatics

• Gene Symbol: KCNJ5