Kinesin 5B Antibody

Images

 
Western Blot: Kinesin 5B Antibody [NBP1-58177] - WB Suggested Anti-KIF5B Antibody Titration: 0.2-1 ug/ml Positive Control: Human brain
Immunohistochemistry-Paraffin: Kinesin 5B Antibody [NBP1-58177] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kinesin 5B Antibody Summary

Immunogen
Synthetic peptides corresponding to KIF5B (kinesin family member 5B) The peptide sequence was selected from the N terminal of KIF5B. Peptide sequence CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSST.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIF5B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against KIF5B and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Kinesin 5B Antibody

  • Conventional kinesin heavy chain
  • kinesin family member 5B
  • kinesin-1 heavy chain
  • KNS1kinesin 1 (110-120kD)
  • KNSKINH
  • Ubiquitous kinesin heavy chain
  • UKHCkinesin heavy chain

Background

Kinesin is the founding member of a superfamily of microtubule based motor proteins that perform force-generating tasks such as organelle transport and chromosome segregation. Kinesin consists of heavy and light chains both of which have been documented to bind a variety of potential linker or cargo proteins. KIF5B is an isoform of kinesin heavy chain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33649
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85344
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87429
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4210
Species: Hu
Applications: WB, IHC
NBP1-46837
Species: Hu, Mu
Applications: WB, IP
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38794
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB500-181
Species: Hu, Mu, Rt, Po, Dr
Applications: WB, ICC/IF, IP
NB500-180
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, ICC/IF, IP
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1205
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-83723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15369
Species: Hu, Mu
Applications: WB, ICC/IF
AF482
Species: Mu
Applications: WB, IHC

Publications for Kinesin 5B Antibody (NBP1-58177) (0)

There are no publications for Kinesin 5B Antibody (NBP1-58177).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kinesin 5B Antibody (NBP1-58177) (0)

There are no reviews for Kinesin 5B Antibody (NBP1-58177). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kinesin 5B Antibody (NBP1-58177) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kinesin 5B Products

Bioinformatics Tool for Kinesin 5B Antibody (NBP1-58177)

Discover related pathways, diseases and genes to Kinesin 5B Antibody (NBP1-58177). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kinesin 5B Antibody (NBP1-58177)

Discover more about diseases related to Kinesin 5B Antibody (NBP1-58177).
 

Pathways for Kinesin 5B Antibody (NBP1-58177)

View related products by pathway.

PTMs for Kinesin 5B Antibody (NBP1-58177)

Learn more about PTMs related to Kinesin 5B Antibody (NBP1-58177).
 

Research Areas for Kinesin 5B Antibody (NBP1-58177)

Find related products by research area.

Blogs on Kinesin 5B

There are no specific blogs for Kinesin 5B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kinesin 5B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF5B
Uniprot