KIF3A Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 430-699 of human KIF3A (NP_008985.3). RKALETKLDMEEEERNKARAELEKREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNMELEERRKRAEQLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIPRDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRKQTPVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGRRKRSAKPETVIDSLLQ |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KIF3A |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence 1:50-1:200
- Immunohistochemistry 1:100 - 1:500
- Immunohistochemistry-Paraffin 1:100 - 1:500
- Immunoprecipitation 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
- Western Blot 1:500-1:2000
|
| Theoretical MW |
80 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for KIF3A Antibody - BSA Free
Background
Microtubule-based anterograde translocator for membranous organelles. Plus end-directed microtubule sliding activity in vitro
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: ICC/IF, WB
Species: Hu, Ma, Mu, Po, Rt
Applications: ICC/IF, IP, KO, Simple Western, WB
Species: Mu
Applications: BA
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
Species: Hu
Applications: PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, PAGE, WB
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Bt, Bv, Ca, Eq, Ha, Hu, Pm, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Bt, Bv, Ca, Eq, Ha, Hu, Pm, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IP
Publications for KIF3A Antibody (NBP3-05030) (0)
There are no publications for KIF3A Antibody (NBP3-05030).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KIF3A Antibody (NBP3-05030) (0)
There are no reviews for KIF3A Antibody (NBP3-05030).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KIF3A Antibody (NBP3-05030) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KIF3A Products
Research Areas for KIF3A Antibody (NBP3-05030)
Find related products by research area.
|
Blogs on KIF3A