EML4 Antibody - BSA Free

Staining of human cell line U-251 MG shows localization to cytosol, intermediate filaments & microtubules.

Immunohistochemistry-Paraffin: EML4 Antibody [NBP1-86805] - Staining of human cerebral cortex, gallbladder, kidney and lymph node using Anti-EML4 antibody NBP1-86805 (A) shows similar protein distribution across tissues to independent antibody NBP2-38319 (B).

Immunohistochemistry-Paraffin: EML4 Antibody [NBP1-86805] - Staining of human lymph node.

Immunohistochemistry-Paraffin: EML4 Antibody [NBP1-86805] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: EML4 Antibody [NBP1-86805] - Staining of human kidney.

Immunohistochemistry-Paraffin: EML4 Antibody [NBP1-86805] - Staining of human gallbladder.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EML4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EML4 Antibody - BSA Free (NBP1-86805) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-EML4 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MSIIQWKLVEKLSLPQNETVADTTLTKAPVSSTESVIQSNTPTPPPSQPLNETAEEESRISSSPTLLENSLEQTVEPSEDHSEEES
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EML4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 109 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control:

  Human Liver Whole Tissue Lysate (Adult Whole Normal)

• Control Peptide:

  EML4 Protein (NBP1-86805PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EML4 Antibody - BSA Free

• C2orf2
• echinoderm microtubule associated protein like 4
• echinoderm microtubule-associated protein-like 4
• ELP120
• EMAP-4
• EMAPL4
• FLJ10942
• FLJ32318
• Restrictedly overexpressed proliferation-associated protein
• Ropp 120
• ROPP120DKFZp686P18118

Background

Echinoderm microtubule associated protein like 4 (EML4) has been identified as part of a gene fusion with the kinase domain of the anaplastic lymphoma receptor tyrosine kinase (ALK) in non-small cell lung cancer. EML4 associates with in vitro polymerized microtubules. In the cell, phosphorylated EML4 associates with the mitotic spindle and is essential for proliferation and microtubule network formation. Alternative names for EML4 include EMAPL4, ropp120, C2orf2, ELP120, and EMAP-4.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EML4 Antibody (NBP1-86805)(4)

Publications using NBP1-86805

• Yigit B, Tufekci D, Viola V et al. Loss of Eml1 alters microtubule-associated protein networks in mouse brain heterotopia. Communications Biology 2025-07-03 [PMID: 40610677]
• Madgwick A, Fort P, Hanson PS et al. Neural Differentiation Modulates the Vertebrate Brain Specific Splicing Program. PLoS One 2015-01-01 [PMID: 25993117] (WB, Human)
• Schoppmann SF, Streubel B, Birner P. Amplification but not translocation of anaplastic lymphoma kinase is a frequent event in oesophageal cancer Eur J Cancer 2013-03-11 [PMID: 23490651] (IF/IHC, Human)
• Preusser M, Berghoff AS, Ilhan-Mutlu A et al. ALK gene translocations and amplifications in brain metastases of non-small cell lung cancer. Lung Cancer 2013-02-27 [PMID: 23453647] (IHC-P, Human)

Bioinformatics

• Gene Symbol: EML4
• Entrez:
  • 27436(Human)
• Uniprot:
  • Q9HC35(Human)