EML4 Antibody

Images

 
Western Blot: EML4 Antibody [NBP1-86805] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-185
Immunocytochemistry/ Immunofluorescence: EML4 Antibody [NBP1-86805] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol, intermediate filaments & microtubules.
Immunohistochemistry-Paraffin: EML4 Antibody [NBP1-86805] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EML4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MSIIQWKLVEKLSLPQNETVADTTLTKAPVSSTESVIQSNTPTPPPSQPLNETAEEESRISSSPTLLENSLEQTVEPSEDHSEEES
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EML4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
109 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
Liver Lysate (NB820-59233)
Control Peptide
EML4 Protein (NBP1-86805PEP)
Publications
Read Publications using
NBP1-86805 in the following applications:

  • IHC
    1 publication
  • 1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25993117).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EML4 Antibody

  • C2orf2
  • echinoderm microtubule associated protein like 4
  • echinoderm microtubule-associated protein-like 4
  • ELP120
  • EMAP-4
  • EMAPL4
  • FLJ10942
  • FLJ32318
  • Restrictedly overexpressed proliferation-associated protein
  • Ropp 120
  • ROPP120DKFZp686P18118

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4210
Species: Hu
Applications: WB, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-1059
Species: Hu, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NBP1-80841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-38740
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01438
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83701
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EML4 Antibody (NBP1-86805)(3)

Reviews for EML4 Antibody (NBP1-86805) (0)

There are no reviews for EML4 Antibody (NBP1-86805). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EML4 Antibody (NBP1-86805) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional EML4 Products

Bioinformatics Tool for EML4 Antibody (NBP1-86805)

Discover related pathways, diseases and genes to EML4 Antibody (NBP1-86805). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EML4 Antibody (NBP1-86805)

Discover more about diseases related to EML4 Antibody (NBP1-86805).
 

Pathways for EML4 Antibody (NBP1-86805)

View related products by pathway.

PTMs for EML4 Antibody (NBP1-86805)

Learn more about PTMs related to EML4 Antibody (NBP1-86805).
 

Research Areas for EML4 Antibody (NBP1-86805)

Find related products by research area.

Blogs on EML4

There are no specific blogs for EML4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EML4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EML4
Entrez
Uniprot