KIF21A Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: QKEAQIKVLEGRLKQTEITSATQNQLLFHMLKEKAELNPELDALLGHALQDLDSVPLENVEDSTDEDAPLNS |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
KIF21A |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for KIF21A Antibody
Background
KIF21A belongs to a family of plus end-directed kinesin (see MIM 600025) motor proteins. Neurons use kinesin and dynein (see MIM 600112) microtubule-dependent motor proteins to transport essential cellular components along axonal and dendritic microtubules.(supplied by OMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, KD, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: All-Multi
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Ma, Mu, Po, Rt
Applications: ICC/IF, IP, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Dr, Hu, Ma, Mu, Pl, Po, Rt
Applications: IB, ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Publications for KIF21A Antibody (NBP2-37969) (0)
There are no publications for KIF21A Antibody (NBP2-37969).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KIF21A Antibody (NBP2-37969) (0)
There are no reviews for KIF21A Antibody (NBP2-37969).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KIF21A Antibody (NBP2-37969) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KIF21A Products
Bioinformatics Tool for KIF21A Antibody (NBP2-37969)
Discover related pathways, diseases and genes to KIF21A Antibody (NBP2-37969). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for KIF21A Antibody (NBP2-37969)
Discover more about diseases related to KIF21A Antibody (NBP2-37969).
| | Pathways for KIF21A Antibody (NBP2-37969)
View related products by pathway.
|
PTMs for KIF21A Antibody (NBP2-37969)
Learn more about PTMs related to KIF21A Antibody (NBP2-37969).
| | Research Areas for KIF21A Antibody (NBP2-37969)
Find related products by research area.
|
Blogs on KIF21A