KIF16B Antibody

Images

 
Immunohistochemistry-Paraffin: KIF16B Antibody [NBP2-14157] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIF16B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KLVNLEKDLVQQKDILKKEVQEEQEILECLKCEHDKESRLLEKHDESVTD VTEVPQDFEKIKPVEYRLQYKERQLQYLLQNHLPTLLEEKQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIF16B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KIF16B Protein (NBP2-14157PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIF16B Antibody

  • C20orf23
  • chromosome 20 open reading frame 23
  • dJ971B4.1
  • FLJ20135
  • KIAA1590
  • kinesin family member 16B
  • kinesin-like protein KIF16B
  • KISC20ORF
  • SNX23kinesin motor protein
  • sorting nexin 23
  • Sorting nexin-23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37969
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-181
Species: Hu, Mu, Rt, Po, Dr
Applications: WB, ICC/IF, IP
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-46837
Species: Hu, Mu
Applications: WB, IP
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83398
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1059
Species: Hu, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
AF6548
Species: Hu, Mu
Applications: IHC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF4248
Species: Hu
Applications: WB, ICC
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NB100-57493
Species: Hu, Mu
Applications: WB, IP
NB300-106
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NBP2-20675
Species: Hu
Applications: WB, ICC/IF
NB500-174
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr

Publications for KIF16B Antibody (NBP2-14157) (0)

There are no publications for KIF16B Antibody (NBP2-14157).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF16B Antibody (NBP2-14157) (0)

There are no reviews for KIF16B Antibody (NBP2-14157). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KIF16B Antibody (NBP2-14157) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIF16B Products

Bioinformatics Tool for KIF16B Antibody (NBP2-14157)

Discover related pathways, diseases and genes to KIF16B Antibody (NBP2-14157). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF16B Antibody (NBP2-14157)

Discover more about diseases related to KIF16B Antibody (NBP2-14157).
 

Pathways for KIF16B Antibody (NBP2-14157)

View related products by pathway.

Research Areas for KIF16B Antibody (NBP2-14157)

Find related products by research area.

Blogs on KIF16B

There are no specific blogs for KIF16B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIF16B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF16B