ANKRD15 Antibody - BSA Free

Immunohistochemistry-Paraffin: ANKRD15 Antibody [NBP1-90167] - Staining of human Kidney shows moderate cytoplasmic positivity in cells in tubules and glomeruli.

Immunohistochemistry-Paraffin: ANKRD15 Antibody [NBP1-90167] - Staining of human Cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal and glial cells.

Immunohistochemistry-Paraffin: ANKRD15 Antibody [NBP1-90167] - Staining of human Heart muscle shows strong cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: ANKRD15 Antibody [NBP1-90167] - Staining of human Placenta shows strong nuclear and cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ANKRD15 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ANKRD15 Antibody - BSA Free (NBP1-90167) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and IP. Anti-ANKRD15 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: INVCGVRKRSYSAGNASQLEQLSRARRSGGELYIDYEEEEMETVEQSTQRIKEFRQLTADMQALEQKIQDSSCEASSELRENGECRSVAVGAEENMNDIVVYHRGSRSCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADKEIE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KANK1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reactivity reported in (PMID: 25961457)
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Immunoprecipitation Reactivity reported in (PMID: 25961457)
  • Western Blot Reactivity reported in (PMID: 25961457)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ANKRD15 Protein (NBP1-90167PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%). Rat reactivity reported in scientific literature (PMID: 25961457).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ANKRD15 Antibody - BSA Free

• ANKRD15ankyrin repeat domain 15
• Ankyrin repeat domain-containing protein 15
• KANKDKFZp451G231
• KIAA0172MGC43128
• Kidney ankyrin repeat-containing protein
• KN motif and ankyrin repeat domain-containing protein 1
• KN motif and ankyrin repeat domains 1

Background

The ANKRD15 gene encodes a protein containing four ankyrin repeat domains in its C-terminus. The suggested role for this protein is in tumorigenesis of renal cell carcinoma. Two alternatively spliced transcript variants encoding different isoforms have been iden

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ANKRD15 Antibody (NBP1-90167)(1)

Publication using NBP1-90167

• Gee HY, Zhang F, Ashraf S et al. KANK deficiency leads to podocyte dysfunction and nephrotic syndrome. J Clin Invest 2015-06-01 [PMID: 25961457] (ICC/IF, WB, IP, Rat, Human)

Bioinformatics

• Gene Symbol: KANK1
• Entrez:
  • 23189(Human)
• Uniprot:
  • Q14678(Human)