ANKRD15 Antibody

Images

 
Western Blot: ANKRD15 Antibody [NBP1-90167] - Analysis in control (vector only transfected HEK293T lysate) and kANK1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: ANKRD15 Antibody [NBP1-90167] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANKRD15 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:INVCGVRKRSYSAGNASQLEQLSRARRSGGELYIDYEEEEMETVEQSTQRIKEFRQLTADMQALEQKIQDSSCEASSELRENGECRSVAVGAEENMNDIVVYHRGSRSCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADKEIE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KANK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ANKRD15 Protein (NBP1-90167PEP)
Publications
Read Publication using
NBP1-90167 in the following applications:

  • 1 publication
  • IP
    1 publication
  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%). Rat, Human reactivity reported in scientific literature (PMID: 25961457).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ANKRD15 Antibody

  • ANKRD15ankyrin repeat domain 15
  • Ankyrin repeat domain-containing protein 15
  • KANKDKFZp451G231
  • KIAA0172MGC43128
  • Kidney ankyrin repeat-containing protein
  • KN motif and ankyrin repeat domain-containing protein 1
  • KN motif and ankyrin repeat domains 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF2988
Species: Mu, Rt
Applications: WB
NBP1-90452
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84071
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00810
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37969
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80963
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF385
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
H00027130-P02
Species: Hu
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12553
Species: Hu
H00058524-R01
Species: Hu
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP2-04508
Species: Hu
AF3505
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-90167
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for ANKRD15 Antibody (NBP1-90167)(1)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 3 applications: ICC/IF, IP, WB.


Filter By Application
ICC/IF
(1)
IP
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Rat
(1)
All Species

Reviews for ANKRD15 Antibody (NBP1-90167) (0)

There are no reviews for ANKRD15 Antibody (NBP1-90167). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ANKRD15 Antibody (NBP1-90167) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ANKRD15 Products

Bioinformatics Tool for ANKRD15 Antibody (NBP1-90167)

Discover related pathways, diseases and genes to ANKRD15 Antibody (NBP1-90167). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKRD15 Antibody (NBP1-90167)

Discover more about diseases related to ANKRD15 Antibody (NBP1-90167).
 

Pathways for ANKRD15 Antibody (NBP1-90167)

View related products by pathway.

PTMs for ANKRD15 Antibody (NBP1-90167)

Learn more about PTMs related to ANKRD15 Antibody (NBP1-90167).
 

Research Areas for ANKRD15 Antibody (NBP1-90167)

Find related products by research area.

Blogs on ANKRD15

There are no specific blogs for ANKRD15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKRD15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KANK1
Entrez
Uniprot