![Immunohistochemistry-Paraffin: ANKRD15 Antibody [NBP1-90167] - Staining of human Kidney shows moderate cytoplasmic positivity in cells in tubules and glomeruli.](http://images.novusbio.com/fullsize/ANKRD15-Antibody-Immunohistochemistry-Paraffin-NBP1-90167-img0007.jpg "Immunohistochemistry-Paraffin: ANKRD15 Antibody [NBP1-90167] - Staining of human Kidney shows moderate cytoplasmic positivity in cells in tubules and glomeruli.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: INVCGVRKRSYSAGNASQLEQLSRARRSGGELYIDYEEEEMETVEQSTQRIKEFRQLTADMQALEQKIQDSSCEASSELRENGECRSVAVGAEENMNDIVVYHRGSRSCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADKEIE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KANK1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Western_Blot_20725.jpg)
![Simple Western NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Simple_Western_20928.jpg)
![Immunocytochemistry NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Immunocytochemistry_16574.jpg)
| Publication using NBP1-90167 | Applications | Species |
|---|---|---|
| Gee HY, Zhang F, Ashraf S et al. KANK deficiency leads to podocyte dysfunction and nephrotic syndrome. J Clin Invest 2015-06-01 [PMID: 25961457] (ICC/IF, WB, IP, Rat, Human) | ICC/IF, WB, IP | Rat, Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for ANKRD15 Antibody (NBP1-90167)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: ANKRD15 Antibody [NBP1-90167] - Staining of human Cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal and glial cells.](http://images.novusbio.com/fullsize/ANKRD15-Antibody-Immunohistochemistry-Paraffin-NBP1-90167-img0005.jpg "Immunohistochemistry-Paraffin: ANKRD15 Antibody [NBP1-90167] - Staining of human Cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal and glial cells.")
![Immunohistochemistry-Paraffin: ANKRD15 Antibody [NBP1-90167] - Staining of human Heart muscle shows strong cytoplasmic positivity in cardiomyocytes.](http://images.novusbio.com/fullsize/ANKRD15-Antibody-Immunohistochemistry-Paraffin-NBP1-90167-img0006.jpg "Immunohistochemistry-Paraffin: ANKRD15 Antibody [NBP1-90167] - Staining of human Heart muscle shows strong cytoplasmic positivity in cardiomyocytes.")
![Immunohistochemistry-Paraffin: ANKRD15 Antibody [NBP1-90167] - Staining of human Placenta shows strong nuclear and cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/ANKRD15-Antibody-Immunohistochemistry-Paraffin-NBP1-90167-img0008.jpg "Immunohistochemistry-Paraffin: ANKRD15 Antibody [NBP1-90167] - Staining of human Placenta shows strong nuclear and cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry PDGF R beta Antibody [Unconjugated]](https://images.novusbio.com/images2/PDGF_R_beta_AF1042_Immunohistochemistry_6669.jpg)
![Western Blot PDGF R beta Antibody [Unconjugated]](https://images.novusbio.com/images2/PDGF_R_beta_AF1042_Western_Blot_17545.jpg)
![Immunohistochemistry PDGF R beta Antibody [Unconjugated]](https://images.novusbio.com/images/af1042_mouse-pdgf-r-beta-affinity-purified-polyclonal-ab-41202410481131.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")