KIAA1024 Antibody

Images

 
Western Blot: KIAA1024 Antibody [NBP1-90947] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: KIAA1024 Antibody [NBP1-90947] - Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Immunohistochemistry: KIAA1024 Antibody [NBP1-90947] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: KIAA1024 Antibody [NBP1-90947] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, Rt, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIAA1024 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IQSSCYNSTGSLSQLHKSDCDSSPEHNLTKIANGVPNSKGDKGNRPENTHHSEEELKTSVCKLVLRIGEIERKLESLSGVRDEISQVLGKLNKLDQKMQQPEKVSVQIDLNSLTSEGPSDDSASPRMFHAHS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA1024
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KIAA1024 Protein (NBP1-90947PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIAA1024 Antibody

  • hypothetical protein LOC23251
  • KIAA1024

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010518-A01
Species: Hu, Ze
Applications: WB, ELISA
NBP2-57648
Species: Hu
Applications: WB, ICC/IF
NBP1-76995
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
49130002
Species: Ce
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-38539
Species: Hu
Applications: IHC, IHC-P
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-53110
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB2668
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-02158
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-32010
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58656
Species: Hu
Applications: WB, ICC/IF, IHC-P
H00055466-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88623
Species: Hu
Applications: IHC, IHC-P
NBP1-80844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
AF4244
Species: Hu
Applications: WB, IHC
NBP2-30936
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90060
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90947
Species: Hu, Mu, Rt, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KIAA1024 Antibody (NBP1-90947) (0)

There are no publications for KIAA1024 Antibody (NBP1-90947).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA1024 Antibody (NBP1-90947) (0)

There are no reviews for KIAA1024 Antibody (NBP1-90947). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KIAA1024 Antibody (NBP1-90947) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIAA1024 Products

KIAA1024 NBP1-90947

Bioinformatics Tool for KIAA1024 Antibody (NBP1-90947)

Discover related pathways, diseases and genes to KIAA1024 Antibody (NBP1-90947). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIAA1024 Antibody (NBP1-90947)

Discover more about diseases related to KIAA1024 Antibody (NBP1-90947).

Blogs on KIAA1024

There are no specific blogs for KIAA1024, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIAA1024 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA1024