ADAMTS7 Antibody

Images

 
Immunohistochemistry: ADAMTS7 Antibody [NBP2-38539] - Staining of human liver shows strong cytoplasmic and membranous positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADAMTS7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LGRAHIRAHTPACHLLGEVQDSELEGGLAAISACDGLKGVFLLSN
Specificity
Specificity of human ADAMTS7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAMTS7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ADAMTS7 Protein (NBP2-38539PEP)
Publications
Read Publication using
NBP2-38539 in the following applications:

  • KD
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31439546).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADAMTS7 Antibody

  • A disintegrin and metalloproteinase with thrombospondin motifs 7
  • a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 7
  • ADAM metallopeptidase with thrombospondin type 1 motif, 7
  • ADAM-TS 7
  • ADAMTS-7
  • ADAM-TS7a disintegrin and metalloprotease with thrombospondin motifs-7 preproprotein
  • COMPase
  • DKFZp434H204
  • EC 3.4.24
  • EC 3.4.24.-
  • EC 3.4.24.82

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-75608
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB
NBP1-59322
Species: Hu
Applications: WB, IHC, IHC-P
AF5465
Species: Hu
Applications: WB, IP
NBP2-38510
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-89246
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-03329
Species: Mu, Rt
Applications: WB, IHC
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NB100-56530
Species: Hu
Applications: WB
NBP2-38539
Species: Hu, Mu
Applications: IHC, IHC-P, KD

Publications for ADAMTS7 Antibody (NBP2-38539)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: KD.


Filter By Application
KD
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for ADAMTS7 Antibody (NBP2-38539) (0)

There are no reviews for ADAMTS7 Antibody (NBP2-38539). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ADAMTS7 Antibody (NBP2-38539) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ADAMTS7 Products

Bioinformatics Tool for ADAMTS7 Antibody (NBP2-38539)

Discover related pathways, diseases and genes to ADAMTS7 Antibody (NBP2-38539). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAMTS7 Antibody (NBP2-38539)

Discover more about diseases related to ADAMTS7 Antibody (NBP2-38539).
 

Pathways for ADAMTS7 Antibody (NBP2-38539)

View related products by pathway.

PTMs for ADAMTS7 Antibody (NBP2-38539)

Learn more about PTMs related to ADAMTS7 Antibody (NBP2-38539).

Blogs on ADAMTS7

There are no specific blogs for ADAMTS7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAMTS7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAMTS7
Uniprot